KEGG   Shewanella putrefaciens 200: Sput200_3601Help
Entry
Sput200_3601      CDS       T02015                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shp  Shewanella putrefaciens 200
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sput200_3601
Enzymes [BR:shp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sput200_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4088514..4089254
Genome map
AA seq 246 aa AA seqDB search
MKVLLTRPEGRNQSMVDALNARGIAHYVTPLLGVEPTNDITTDASHPLAGTDIIICISAN
AVIFANKALNKINAQIATWPKVQYFAVGHATWEALDQLGICAVEAPDDCQQTEGLLTLAS
LQHIPAKKVTIIRGVGGREALAEQLTSRGANVRYWEVYQRVCPPLDGYAITQQWQHFGID
TIVVTSGEVLNNLIKLVPKELFAWLRSCHIIVPSNRVEAQAHAFGINHVTNACAANSKAV
LNALKL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgttactgacgcgcccagaagggcgcaatcagtctatggtcgatgccttgaat
gcacgaggcattgcccactatgtcacgccattattgggtgttgaaccaactaacgacatc
acaacggatgcttcgcatccattggcagggacagatattattatctgtatcagtgctaac
gctgttatttttgcgaataaagccttaaacaaaattaatgcacaaatagcaacatggcct
aaagttcaatattttgctgtgggccatgcaacatgggaggcattagatcagttaggcatt
tgcgcagttgaagcccccgatgattgccaacaaacggaaggcttacttacccttgcttct
ctacaacatattccagctaaaaaagtaacgattatacgtggtgttggtggccgcgaagct
ctcgctgagcaattaaccagccgtggcgcaaatgtacgctattgggaagtatatcagcga
gtgtgtccaccgttagacggatatgctattacacaacaatggcaacactttggtattgat
accattgtggtcaccagtggcgaagttctcaataacctgattaaactagtgccaaaagag
ttatttgcatggctgcgctcatgtcatatcatagtcccaagtaaccgagtagaagctcaa
gctcacgcctttggtataaaccacgtcaccaatgcctgtgccgccaacagcaaagccgtg
ctaaacgcccttaaactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system