KEGG   Shigella sp. PAMC 28760: A0259_14940Help
Entry
A0259_14940       CDS       T04390                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shq  Shigella sp. PAMC 28760
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:shq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0259_14940
   00630 Glyoxylate and dicarboxylate metabolism
    A0259_14940
   00640 Propanoate metabolism
    A0259_14940
   00650 Butanoate metabolism
    A0259_14940
  Lipid metabolism
   00071 Fatty acid degradation
    A0259_14940
   00072 Synthesis and degradation of ketone bodies
    A0259_14940
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0259_14940
   00310 Lysine degradation
    A0259_14940
   00380 Tryptophan metabolism
    A0259_14940
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A0259_14940
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A0259_14940
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A0259_14940
Enzymes [BR:shq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A0259_14940
Exosome [BR:shq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0259_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2996597..2997781
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSQHVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAQSIVAGGMENMSL
APYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELA
LHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAG
TVTAGNASGINDGAAALVIMEESAALAAGLTPLARIKSYASGGVPPALMGMGPVPATQKA
LQLAGLQLADIDLIEANEAFAAQFLAVGKNLGFDSEKVNVNGGAIALGHPIGASGARILV
TLLHAMQARDKTLGLATLCIGGGQGIAMVIERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagtgcggtacgtactgctatcggtagttttaacggttca
ctcgcttccaccagcgccatcgacctgggggcgacagtaattaaagccgccattgaacgt
gcaaaaatcgattcacaacacgttgatgaagtgattatgggtaacgtgttacaagccggg
ctggggcaaaatccggcgcgtcaggcactgttaaaaagcgggctggcagaaacggtgtgc
ggattcacggtcaataaagtatgtggttcgggtcttaaaagtgtggcgcttgccgcccag
gccattcaggcaggtcaggcgcagagcattgtggcggggggtatggaaaatatgagttta
gccccctacttactcgatgcaaaagcacgctctggttatcgtcttggagacggacaggtt
tatgacgtaatcctgcgcgatggcctgatgtgcgccacccatggttatcatatggggatt
accgccgaaaacgtggctaaagagtacggaattacccgtgaaatgcaggatgaactggcg
ctacattcacagcgtaaagcggcagccgcaattgagtccggtgcttttacagccgaaatc
gtcccggtaaatgttgtcactcgaaagaaaaccttcgtcttcagtcaagacgaattcccg
aaagcgaattcaacggctgaagcgttaggtgcattgcgcccggccttcgataaagcagga
acagtcaccgctgggaacgcgtctggtattaacgacggtgctgccgctctggtgattatg
gaagaatctgcggcgctggcagcaggccttacccccctggctcgcattaaaagttatgcc
agcggtggcgtgccccccgcattgatgggtatggggccagtacctgccacgcaaaaagcg
ttacaactggcggggctgcaactggcggatattgatctcattgaggctaatgaagcattt
gctgcacagttccttgccgttgggaaaaacctgggctttgattctgagaaagtgaatgtc
aacggcggggccatcgcgctcgggcatcctatcggtgccagtggtgctcgtattctggtc
acactattacatgccatgcaggcacgcgataaaacgctggggctggcaacactgtgcatt
ggcggcggtcagggaattgcgatggtgattgaacggttgaattaa

DBGET integrated database retrieval system