KEGG   Sarcophilus harrisii (Tasmanian devil): 100913201Help
Entry
100913201         CDS       T02286                                 

Gene name
NSD1
Definition
nuclear receptor binding SET domain protein 1
Orthology
K15588  
histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:shr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2717 aa AA seqDB search
MDQTCELPRRNCLQPFSNRVDLDAPEEKDTPFGNGQSNISEPLNGCAIQLSAAINSGTSK
ITYGQDPSSCYIPLRRLQDLASMINVEYLNGSTDGSESLQDPEKRDSRSGSPNVCTSLSP
SDPRALAMKQEPTCNDSPEFKVKITKTVKNGILHFDNFVCMEDADTDIESEMDTEQPGTE
DDSIDETFEKTRQDLTKTNATCNYQPQSENGIEVLMGIEQDSTTESCEIKSPVLPLAPNE
MQKNNQRTAMDSRIEKPELHPGPCSLGDTNITLEEQLNSINLSFQDDPDSSTSTLGNMIE
LPGTSSSSTSQELQFCQPKKKPAPLKYGVGQLVWAKFNRRPWWPSRICCDPLMNTHSKMK
VSSQRPYRQYYVEALGDPSEKAWVAGKSIVLFEGRHQFEELPVLRRRGKQKEKGYRHKVP
KKILSKWEASVGLAEQRDIPKDFKVRKRIRSSTKLDSEEDMPFEDCTNDPESEHERVLNG
CLKSLAFDSETSSDEKVKPCTKSRVRKRSTSLKRTSIKKSSMPFEAHNEERREKMTETLG
LNYVSGDVSDKQASTELCRIASSLTAASNTTTTNYLFSSRGKTTMKKEFETSNCDSLLGL
PESVLISSSSVERKKPLRSMVHSAKSPHLCYISAGDEEKRSDSASLWTTSDDESSDSDLD
PVDQSSESDESTLEISGSFDKDESELPLEKNEKLQYSRYHTKNTRVKARKKSIKTSSHLD
HLLDCTKTPDPGSEESQGADSDSKMPIIARNDNLSNKYTLPQNISHENAFVKSGLSNQPL
LQSKHNKQPKARSIKCKHKESPTAVDSSVLEEDFSLKCCSNDSKGSSVDCVVKSGKLDSL
KLLSNMHEKPRDSAEIETAVVKHVLSELKELSYRSLNDEISDSGSPKINKPLLFPSSSGQ
SRLPIEPNYKFSTLLMMLKDMHDSKTKEQQLMTTQNVVSYRNPGLGDCSSSSAAGGSKSL
VSGSLTHKAEKNGDCIQDSICQNPGGSESSLIREPSGSLTGLLTKKRRLTASGKRRANCI
TRRNCARSKSSKLQDDFLAQREKDIIESKDLKSEKKKKLNQLPSMTIETALSECKDVPDS
VNKSLSSRPADSKRKQSLQLMEHLTGEDCAHFSDVHFDSMVKKSDPDKNPEKCPSFENGE
VLELDSEMNSESSLSDESNDINHVAPKKRWQRFNQSRAKTSKRISRSRREKNSKSAFGGL
HPCDFLLEGNEGPENRPSSPSKVLEEEIKQNCEGRLDVVVPQLNVCDKPNSDGLHRESGL
SNFPPQPELSTQDARSEKKRLRRPSRWLLEYTEKYDQIFAPKKKQKKVQEQSKVSSPREN
EAQTTRCQSSTDLQNKPVEESSSTKEDPPVLEREAPFLERPIGQSELGGGNAELPELTLS
VPITPEVSSWSSLEPEESLLKPRNYESKRQRKPTKKLLESNDLDPGFMPKKGDLTLLRKC
YNTGPLENDISGSCTTLTSMDFGEGANKVFEKQRKRKRQRHVPAHCKKVRNEDSSREAQN
SEGEPVTSGTTSSPKDAIEESVEHDHGMPVSKKIQAERGGGAALKENVCQNCEKVGELLL
CEAQCCGAFHLECIGLTEMPKGKFICKECRTGIHTCFVCKTSGEDVKRCLLPLCGKFYHE
ACIQKYPPTVLQNKGFRCSLHMCITCHAANPASLSASKGRLMRCVRCPVAYHANDFCLAA
GSKVLASNSIICPNHFAPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNID
IPEGNWYCNDCKAGKKPHYREVVWVKVGRYRWWPAEICHPRAIPSNIDKMRHDVGEFPVL
FFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAVRFEELKAQKELRQL
QEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKASDDNPCGIDSECINRMLL
YECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELID
EEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGD
TRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNHPNPTEEKSK
KLKRKQQVKRRSQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKW
ECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGE
IREYVPPPVPLTSGANTQLAEQPSEIPAQRPLMVDKAPGAMGQRLQLSEKTLVGTCQRPQ
LSDKPLVMPDSTPQSPDKIPGVSGSRPQPLELGQRPADTSLVVTSPKPQLSDKPPLSGSK
SPPSVRSSVAAGLRSQLLDRPLVTSPRPQSLDKSLGSLSSKSQQLDRPVVTAGPRLQASD
KSPVTNGPKPQISDKPPVTTGPKPQTSDRPLAPLGQRLPSSEKVLSAVVQNLVSNEKALR
PVDQNTRPKDRATMVIELSPRQKERATSPHEITPQPTEKLPVLEQSPWPVNKALGQMPRA
AEKVHPSEPVLQASGRASAPVEHTWQAGKTLIQARLVPRPPAKGYLFEQAPRATGRAPVS
MEQSSGSFGKALASGEPMAGSPQPPGLATKATPLMVQSPRPPVKSPDLVPPAEKRSAVTE
HPPWALGKSPAGPTPWPAGKPLAQTCRSPGSPQTLAQTCRPLDKGLIKGPDPKPEQSAVP
ALNQTPSSHEPAESKEK
NT seq 8154 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacctgtgaactgcccagaagaaattgtctgcagcccttttctaacagagtg
gatttagatgcccctgaagaaaaggacacccctttcggtaatggtcaatccaatatttct
gagcctcttaatgggtgtgctatacaattatcggctgccattaatagtggaacatccaaa
attacttatggacaagatccatcatcttgttacattccactgcggcgactacaggatttg
gcctccatgatcaatgtagaatatttaaatgggtctactgatggatcagaatcccttcaa
gaccctgaaaagagagattcaagatctgggtcaccaaatgtttgcacttccttgagtcct
agtgatccaagagcacttgctatgaaacaggaacccacttgtaatgactcccctgagttc
aaggtaaaaataacaaagactgtcaagaatgggattctacactttgacaattttgtttgt
atggaagatgcagatacagatatagagtctgaaatggacacagagcagccaggcacagag
gatgacagtatagacgaaacctttgaaaaaacaaggcaagacctaactaagacaaatgct
acctgcaattaccagccccaatcagagaatggtatagaagtgctcatgggaattgaacaa
gacagcacaacagaaagttgtgaaataaagtcaccagttttaccattagctccaaacgaa
atgcagaaaaataatcaaagaactgccatggacagcagaattgaaaagccagagcttcac
ccaggcccctgttcactaggagatacaaatattacattagaagaacaattaaactccata
aatttatcttttcaggatgatccagactccagtaccagtacgttaggaaacatgatagaa
ttacctggaacatcatcatcatctacttcacaagaattacaattttgtcaacccaagaaa
aagcctgctcccttgaaatacggagttggacaacttgtctgggcaaaattcaacagacgt
ccatggtggcccagcagaatttgttgcgatccattaatgaacactcactcaaaaatgaaa
gtttccagccaaaggccttatcgccaatactacgtggaagctttaggagatccttctgaa
aaagcgtgggtggcaggaaaatcgattgtcctatttgaaggaagacatcagtttgaagag
cttcctgtattgaggagaagaggcaaacagaaagaaaaaggctatagacataaggttcct
aagaaaatcttgagtaagtgggaagccagcgttggacttgctgagcagcgagatattcct
aaggattttaaggtcagaaagcgtatcagaagttcaacgaaactagacagcgaagaagat
atgccttttgaggactgtacaaacgatcctgaatcggagcatgaacgagtactgaatggc
tgcctgaaatcactagcctttgactctgaaacctcatcagatgaaaaggtgaagccgtgc
actaaatctcgagtcagaaagagatccacaagcctcaaaaggactagtattaaaaaaagc
agcatgccatttgaagctcataatgaagaaagaagggaaaagatgacagagactcttggc
ctgaattatgtttctggagatgtgtccgataagcaggcttctactgaactatgcagaata
gcaagcagtcttacagcagcatccaacaccaccaccacaaattacttgttttcttcacgt
gggaaaaccactatgaaaaaagagtttgagacttcaaattgtgattctctgcttggtttg
cctgagagtgttttgatttctagcagttctgtggagagaaagaaacctctccgcagtatg
gttcatagtgcaaagtcaccccatctgtgctatatcagtgctggtgatgaggaaaagaga
agtgattcagccagtttatggaccacctctgatgatgagagcagtgacagtgatctggac
ccagttgaccaaagttctgagtctgatgaaagtactctagaaataagtggatcttttgat
aaagatgaaagtgagttacctttggagaaaaatgagaagcttcaatattccaggtatcac
acaaagaatactagggtaaaagcaagaaagaagtctataaaaactagttcacacctagac
cacttgttagattgtactaaaactcctgaccctgggagtgaagaatctcaaggtgctgat
tctgattccaaaatgcccatcatcgctcgaaacgacaatctttccaacaaatacaccctg
ccacaaaacatatcccatgagaatgctttcgtaaagagtgggcttagtaatcaacctctg
ttacaatcaaaacataacaaacagcctaaagccagaagtataaaatgcaaacacaaagag
agcccaactgcagtagattcctcagttttagaggaggatttcagcttaaagtgctgttct
aatgattcgaaagggtcttctgtagactgtgttgtcaaaagtggaaagcttgatagtcta
aaactactgagcaacatgcatgagaaacccagagattctgcggaaattgaaaccgctgtt
gtaaaacatgttttgtcagagttgaaagaactgtcttatagatccctaaatgatgaaata
agtgactctggttcacctaaaataaacaaacctttactttttccttcttcatctggtcaa
agtcgtttgccaattgagccaaattacaaattcagcaccttattgatgatgttgaaagat
atgcatgatagtaagactaaggaacagcagctaatgaccactcaaaatgtggtctcctat
cgtaatcctggccttggagactgttccagcagcagtgctgcaggtggctcaaagtcccta
gtttcaggaagcctgactcataaggctgaaaaaaatggagattgtattcaggactcaatc
tgtcaaaaccctggtgggagtgagtcttctctcatccgagagccatctggatctttaact
ggattactcactaagaaaagaaggctcactgcttctggcaaacgtcgagcaaactgtatt
actcggagaaattgcgcgagatccaagtcatccaaactgcaggatgactttttggcacaa
agagaaaaggacattatagaaagcaaagacttgaaatcagaaaagaaaaagaaactaaac
caactacccagtatgaccattgagactgcactgagtgaatgcaaagatgtcccagattca
gtaaataagtctctaagcagcaggcctgcagattcgaaaagaaagcagtctcttcaatta
atggaacatttaacaggtgaagactgtgcacatttttctgatgtccattttgattccatg
gttaaaaaatctgaccctgataaaaatcctgaaaagtgcccctcttttgaaaacggggaa
gtcctagagctggactctgaaatgaacagtgaaagctccctgagtgatgaatctaatgat
ataaaccatgtggcacccaaaaagcggtggcagcgttttaaccaaagcagagctaaaacc
agtaagcgcatcagtagatctaggagggaaaagaactcaaagagtgcctttgggggccta
cacccttgtgactttctgctggaggggaatgagggcccagagaataggccttccagccct
tccaaggtgctagaggaagaaattaaacagaattgtgagggtcgcttagatgtagttgtg
ccacagttgaatgtgtgtgataagccaaacagtgatgggctgcacagagaatcagggctt
tccaattttcctccacagcctgagctctccacacaagatgcacgctcagagaagaaacgt
cttaggaggccaagcagatggcttctggaatatacagaaaaatatgaccagatatttgct
cccaagaaaaaacaaaagaaggtacaggaacagtctaaggtaagttccccaagagaaaat
gaagcccagactacacggtgtcaatctagcactgatctccagaataaaccagtggaagag
agctcttcaaccaaagaagatcctccagtccttgagagagaggcaccatttttggaaaga
ccaataggtcagtctgaacttggaggtggaaatgcagagttgccagaactgaccttgtct
gtgccaatcacacctgaagtttcttcttggtcttcactggaaccagaggagtcattattg
aaaccaagaaattatgaaagtaagcgtcagaggaagccaacaaaaaagctccttgaatcc
aatgatttagatcctggatttatgcccaagaaaggggatttgacactccttagaaagtgt
tataatactggtcccttggagaatgatatttctggatcatgtacaacgctcacatctatg
gattttggtgaaggtgcaaacaaagtttttgaaaagcaaaggaagcgaaagagacagagg
catgtaccagcacattgtaagaaagtgagaaatgaagactcttcacgggaggctcaaaac
tctgagggagaaccagttacttctgggactacctcaagccccaaagatgccatagaagag
agtgtggaacatgatcatgggatgcctgtatctaaaaaaatacaggctgaacgtggtgga
ggagcagctctcaaggaaaatgtttgtcagaactgtgagaaagtgggtgagttgttgcta
tgtgaggctcaatgttgtggtgccttccacctggaatgtattggcctgacagagatgcca
aaaggcaaatttatctgcaaggaatgtcgaacaggaattcatacctgctttgtgtgtaaa
accagtggagaagatgtcaaaaggtgtttgctacctctttgtggaaagttttaccatgaa
gcctgtatacagaaatatccgccaactgtcctacagaacaagggttttcggtgctccctt
cacatgtgtataacctgtcatgctgctaatccagctagtctttctgcatctaaaggtcgc
ctaatgcgctgtgtccggtgtcctgtggcttaccatgccaatgacttctgtctggctgca
ggatcaaaggtccttgcatcaaatagcatcatctgccctaatcattttgctcctcggagg
ggttgcagaaatcatgaacatgttaatgttagctggtgttttgtatgctcagaagggggc
agtcttttgtgctgtgactcttgccctgctgcatttcatcgagaatgtctgaatattgat
atcccagagggcaactggtattgcaatgactgtaaggcaggcaaaaagccacactatcga
gaagttgtctgggtaaaagttggccgatataggtggtggccagctgaaatttgtcatcct
cgagctattccttccaatattgataagatgagacatgatgttggtgaatttccagtttta
ttttttggctctaatgattacttatggacccatcaggctcgtgtctttccatatatggaa
ggagatgtcagtagcaaggacaaaatggggaaaggtgttgatgggacatataaaaaagct
cttcaggaagctgctgtccgttttgaggaattaaaagcccagaaagaactaagacagctt
caggaagacagaaaaaatgataagaaaccaccaccttacaaacatatcaaggtgaaccgt
ccaataggcagggttcagatctttactgcagacctgtcagagattccccgatgtaactgt
aaagcttcagatgacaacccctgtggcatcgattcagaatgcattaaccgaatgctcctg
tatgagtgccatcccactgtctgtcctgcgggcggacgctgccagaaccaatgcttctca
aaacgccagtatcctgaagttgaaatctttcgtaccttacagcgaggctggggcttacgg
acaaaaacagatattaaaaagggtgaatttgtaaatgagtatgtgggagagctgatagat
gaagaggaatgtagagctcgaatccgttatgcccaagaacacgacatcaccaatttctac
atgctcactttggataaggaccggattattgatgctggtcccaaaggaaattatgcccgg
tttatgaatcactgttgccaacccaactgtgaaactcagaagtggtctgtgaatggagat
acccgagttgggctttttgccctaagtgacatcaaagcaggcactgaactcacctttaac
tacaatctagagtgtcttgggaatggaaaaactgtttgcaaatgtggagcaccaaattgt
agcggtttcttgggtgttcggccaaagaatcatcccaatcccacagaagagaaatccaaa
aaactaaaaagaaaacaacaggtaaagcgtcgatcccagggtgagatcacaaaagaaaga
gaagatgaatgtttcagctgtggagatgcagggcagcttgtatcctgtaagaaaccaggt
tgtcctaaagtctatcatgctgactgcctcaacttgacaaaaaggcctgcagggaaatgg
gaatgtccatggcaccaatgtgatgtttgtggaaaagaagctgcatctttttgtgagatg
tgtcctagttccttttgtaagcaacatcgagagggaatgctgttcatctctaaactggat
ggtcgcctgtcttgtacagagcatgatccatgtggccccaaccctctggagcctggggag
atccgtgagtacgtgcctccccctgtgccgctgacttcaggtgcaaacactcagctagca
gagcagccttctgagattcctgctcaaagacccctgatggtggacaaagcccctggggca
atgggccaaaggctccagctgtcagagaaaacattagtaggaacatgtcagaggccacag
ttgtctgataaaccacttgtgatgcctgactccacgccccagtcaccagataagatccct
ggagtatcagggtcaagacctcagcccttagaattaggccagaggccagcagacacatct
cttgtagtgacaagccccaaacctcaactgtctgataaacctccattgtcaggttccaaa
tctccaccatcagttaggtcctcagtagcagctggcctcagatcccaactcttggacaga
cctctagtaaccagcccaaggcctcaatctctggataagtccttgggttctctcagctca
aagtctcagcaattagataggcctgtagttactgctggaccaagactccaggcatcagac
aagtccccagttacaaatggcccaaagccccagatctcagacaagcccccagtgacaact
ggacctaaaccccagacctcagacaggccccttgcccctttgggccagagactcccatct
tcagaaaaagtgctgtcagctgtggtccagaaccttgtatctaatgaaaaagcactaagg
cctgtggaccaaaatactcggccaaaagatcgagctactatggttattgaactgagtcct
cgtcaaaaggaacgagcaacttcacctcatgaaattacaccccagcccactgaaaaatta
ccagtgctggagcagagtccctggcctgttaacaaagcactgggacaaatgcctcgggca
gctgagaaagttcacccttctgaaccagtcctccaagcatctggaagagcttcagcccct
gtggaacacacctggcaggctggcaaaacactcatacaagccagactcgtcccgcggccc
cctgccaagggttacttgtttgaacaggctcctcgggccacaggacgtgcacctgtgtca
atggagcagagctctgggtccttcggcaaagccttagcctcaggagaacccatggctgga
tcccctcaacccccagggcttgccacaaaagcaacaccattgatggtgcagtcccctagg
ccccctgtcaaatcaccagaccttgttcccccagcagagaaacggtcagcagtgacagag
caccccccctgggccctggggaaatccccagcaggccccactccctggcctgcaggcaaa
ccactggcacagacttgtcggtcacctgggagtccacagacattggcacagacttgtcgg
ccccttgacaaagggctaatcaaagggccagaccctaagcctgagcaaagtgcagtacca
gctcttaaccagaccccttccagccatgagcctgcagaatcgaaagagaagtga

DBGET integrated database retrieval system