KEGG   Sarcophilus harrisii (Tasmanian devil): 100913206Help
Entry
100913206         CDS       T02286                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:shr04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 405 aa AA seqDB search
MDKSKENSVSGPSNKTTILLGEGPKRVPVTQHISSQNRLPASSGQAQRVLRPSNTLLVSS
QTQKNVSSHKAVQTQQSQKLQPAAVIPPTSRPPNNTQNTEQSQTAVSASAPGKGETPKQK
NEETKKRQWALDDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRELQKLSKFDEQRTATYITE
LADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSISKVEYKFPDFVTEGARDL
ISRLLKHNPYQRLTLKELLEHPWIIANSSKSPSNQKSKESNSVKS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatctaaagaaaacagtgtttcaggacctagcaacaagacaacaattctactt
ggagaaggtccaaaacgtgtgcctgtaactcagcatatttcttcccagaatcggttacct
gcaagcagtgggcaagctcaacgagtcttacgtccttcaaatactcttctagtttcttct
cagacacaaaagaatgtctctagtcacaaagcagttcagactcaacagtcacagaagtta
cagccagcagcggtaattcctcctacatcaagaccaccaaataacactcaaaacactgag
cagtctcagacagcagtgtctgcaagtgctcctggaaagggagaaacaccaaagcagaaa
aacgaggaaacaaaaaaaaggcagtgggcattggatgactttgaaattggtcgccctttg
ggaaaaggaaagtttggaaatgtttacttggcacgagagaagcagagcaagtttatcctg
gctcttaaagtactctttaaggcccaactggaaaaagcaggagttgaacatcaactgagg
cgagaagtagaaatacagtctcatcttaggcatcctaatattttgagattatatggttat
tttcatgatgccacaagagtttacctaattctagaatatgcacctcgtggagaagtttat
agagagcttcaaaagctttcaaagtttgatgaacaaagaacggctacttatatcacagag
ctggcagatgccttatcatattgccactcaaaaaaggtgattcatcgagacattaagcca
gagaatttactacttggatcagatggcgagctgaagattgcagattttggctggtcagtt
catgctccatcatctaggaggacaactctttgtggcacacttgactatctacctcctgag
atgattgaaggcagaatgcatgatgaaaaggtggacctatggagtcttggagttctatgc
tatgaatttctagtaggaaaacctccttttgaggcagaaacatatcaagaaacttacaga
agcatttcaaaggttgaatataaattccctgactttgtaacagaaggggctagggatctc
atttcaagacttttgaagcataatccttaccaaaggctgacactaaaggagctccttgaa
catccttggatcatagcaaattcttcaaaatcaccaagcaaccaaaaaagcaaagaatca
aatagtgtaaagtcttaa

DBGET integrated database retrieval system