KEGG   Sarcophilus harrisii (Tasmanian devil): 100913206Help
Entry
100913206         CDS       T02286                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100913206 (AURKA)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100913206 (AURKA)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100913206 (AURKA)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100913206 (AURKA)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100913206 (AURKA)
   Spindle formation proteins
    100913206 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100913206 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 405 aa AA seqDB search
MDKSKENSVSGPSNKTTILLGEGPKRVPVTQHISSQNRLPASSGQAQRVLRPSNTLLVSS
QTQKNVSSHKAVQTQQSQKLQPAAVIPPTSRPPNNTQNTEQSQTAVSASAPGKGETPKQK
NEETKKRQWALDDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRELQKLSKFDEQRTATYITE
LADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSISKVEYKFPDFVTEGARDL
ISRLLKHNPYQRLTLKELLEHPWIIANSSKSPSNQKSKESNSVKS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatctaaagaaaacagtgtttcaggacctagcaacaagacaacaattctactt
ggagaaggtccaaaacgtgtgcctgtaactcagcatatttcttcccagaatcggttacct
gcaagcagtgggcaagctcaacgagtcttacgtccttcaaatactcttctagtttcttct
cagacacaaaagaatgtctctagtcacaaagcagttcagactcaacagtcacagaagtta
cagccagcagcggtaattcctcctacatcaagaccaccaaataacactcaaaacactgag
cagtctcagacagcagtgtctgcaagtgctcctggaaagggagaaacaccaaagcagaaa
aacgaggaaacaaaaaaaaggcagtgggcattggatgactttgaaattggtcgccctttg
ggaaaaggaaagtttggaaatgtttacttggcacgagagaagcagagcaagtttatcctg
gctcttaaagtactctttaaggcccaactggaaaaagcaggagttgaacatcaactgagg
cgagaagtagaaatacagtctcatcttaggcatcctaatattttgagattatatggttat
tttcatgatgccacaagagtttacctaattctagaatatgcacctcgtggagaagtttat
agagagcttcaaaagctttcaaagtttgatgaacaaagaacggctacttatatcacagag
ctggcagatgccttatcatattgccactcaaaaaaggtgattcatcgagacattaagcca
gagaatttactacttggatcagatggcgagctgaagattgcagattttggctggtcagtt
catgctccatcatctaggaggacaactctttgtggcacacttgactatctacctcctgag
atgattgaaggcagaatgcatgatgaaaaggtggacctatggagtcttggagttctatgc
tatgaatttctagtaggaaaacctccttttgaggcagaaacatatcaagaaacttacaga
agcatttcaaaggttgaatataaattccctgactttgtaacagaaggggctagggatctc
atttcaagacttttgaagcataatccttaccaaaggctgacactaaaggagctccttgaa
catccttggatcatagcaaattcttcaaaatcaccaagcaaccaaaaaagcaaagaatca
aatagtgtaaagtcttaa

DBGET integrated database retrieval system