KEGG   Sarcophilus harrisii (Tasmanian devil): 100913260Help
Entry
100913260         CDS       T02286                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 588 aa AA seqDB search
MGGAARGPGRKDAGPPRAGPPAQEPRRLGDGVYDTFMMLDETKCPPGSNTTCNPSEPALP
RRLYITTEKLTTNHIQPISNGGDIKVEQLFQEFGNRRTNAFQSVGTNSSEKYPSTISQGK
SSDSLNTVKSGSSSKALKVVPLTPEQALKQYKHHLTPYEKLEIINYPEVYFVGPNAKKRH
GVMGGPNNGGYDDAEGGYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLHQYVALKM
VRNEKRFHRQAAEEIKILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELI
KKNKFQGFSVQLVRKFAQSILQSLDALHRNKIIHCDLKPENILLKQHGRSATKVIDFGSS
CFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDVWSFGCILAELLTGQPLFPGEDEGDQLA
CIMELLGMPPPKLLEQAKRAKYFINSKGLPRYCSVTTQPDGRAVLVGGRSRRGKKRGPPG
SKDWVTALKGCDDYLFVEFLKRCLHWDPSARLTPAQALRHPWISKPIPRPLTTDKMPGKR
IVNPVNALQGLGSKLPPVTGIANKLKANLMSETNGSIPLCSVLPKLIS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgctgcccgcgggccgggcaggaaggatgcggggccgccgcgagctgggccc
ccagcccaggaaccacgaaggttgggagatggtgtgtatgacaccttcatgatgttagat
gaaactaaatgtccacctggttccaatacaacctgcaacccttctgaaccagctctacct
agaagattatatattactactgaaaagctaacaacaaaccacattcaaccaatctcaaat
ggaggtgacattaaggtggaacaactgtttcaggaatttggcaacagaagaaccaatgct
tttcaatcagtaggaacaaatagctctgaaaagtatccttccacaatttctcagggtaaa
agttcagacagtttgaacactgtcaaatctggtagctcatccaaagctctaaaagtggta
cctctgactcctgaacaggcactaaagcagtataagcatcatctgactccttatgagaag
ctagaaatcatcaattatcctgaagtttattttgtgggtccaaatgctaagaaaagacat
ggtgtcatggggggccccaacaatgggggatatgatgatgctgagggaggctacattcat
gtacctcgagaccacttagcttataggtatgaggtgctgaaaatcattgggaaaggcagc
tttgggcaagtagctcgagtatatgaccacaaacttcaccagtacgttgccctgaagatg
gtccgcaatgaaaagcgctttcatcgacaagctgctgaagaaattaagattttagagcat
cttaagaaacaggataaaacaggcagcatgaatgttattcacatgctagaaagctttaca
ttccggaatcatgtctgtatggcttttgaattgctaagcatagacctctatgagctgatc
aaaaagaacaaatttcagggattcagcgtccagctggtgcgcaaatttgctcagtctatt
ttgcagtctctggatgctcttcatagaaacaagatcattcactgtgacctgaaaccagaa
aacattcttctaaaacaacatggccgcagtgcgaccaaggtcattgactttggctccagc
tgttttgagtaccagaaactgtacacgtatatccagtctcgcttttacagagcaccagag
atcatcttgggaagtcgatacagcacgcctattgatgtctggagctttggctgtattctt
gcagaactcttgactggacagcctctcttccctggagaggatgagggggaccagttagct
tgcataatggagcttctagggatgccccctccaaaacttctcgagcaagctaagcgtgcc
aagtactttatcaactccaagggtctgcctcgatattgttctgtgactactcagccagat
ggcagagctgtccttgttggggggcgttcacgccggggtaagaagcgaggtcccccaggc
agcaaagactgggtaacagcactaaaagggtgtgatgactacttgtttgtagagttctta
aaaagatgtcttcattgggacccttctgctcgcctaaccccagctcaggctttaagacat
ccttggattagtaaacccatacccagacctctcactacagacaaaatgccagggaaacgg
atagtaaatcctgtgaatgctttgcaaggattgggttccaagttgcctccagttactgga
atagccaacaagcttaaagctaatttaatgtcagaaactaatggcagtatacctttgtgc
agtgtcctgccaaaactcatcagctag

DBGET integrated database retrieval system