KEGG   Sarcophilus harrisii (Tasmanian devil): 100913272Help
Entry
100913272         CDS       T02286                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100913272 (EHHADH)
   01212 Fatty acid metabolism
    100913272 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100913272 (EHHADH)
   00650 Butanoate metabolism
    100913272 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    100913272 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100913272 (EHHADH)
   00310 Lysine degradation
    100913272 (EHHADH)
   00380 Tryptophan metabolism
    100913272 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100913272 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100913272 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100913272 (EHHADH)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100913272 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100913272 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     100913272 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 713 aa AA seqDB search
MSLPDTPPSPQVPFATAARTLRTREMLPKPVIEGLLNSLRKAETDLAVKSIVICGADGKF
SAENPSISERLLSGYGTSSTVLGSEETVTETEESKGLEELRDTVFTQAQVGLPEVTIGLL
PGAQGTQLLPRLIGVPAALDLITSGRHILASEALKLGILDKIVNADPVEEAIKLAKSVSG
QSISSRRLIMRQVQNLPNMDIIFQETLLRMRKQYPGCISREACVQAVQAAVQYPYLEGKE
REKELFLYLVTSGQARALQYAFFAERIVRKWSTPSGASWKTSSGKPISSAAVVGLGTMGR
GIVISLIMAGIPVIAMEQDEQQLDGAKRMIFFVLEQEASKRKGSGQEWRQPRLRFTTSLD
EVAGTDLVIEAVFEEMGLKKQVFGSLSARCQPSALLCTNTSCLDVDELALCTGRPHQVIG
THFFAPAHRMKLLEVIPSRYSSPTTIATVMGLAKTLQKVGVVVGNCLGFVGNRMLMAFNE
QNYFLLEDGSRPEEIDQVLEEFGFRMGPFRVADLSGLDVGWKSRKGQGLTGPLVAPGTPL
RQRGGRRYCPIPDILCEHGRLGQKTGRGWYQYDKPTGWRHQPDPWLSKFLSEYRREHEIE
PRAITSEEILERCVYSLINEGFRLLEEGMAAGPEHIDVIYNNGYGWPRHRGGPMFYASTV
GLPTVAERLQKYYQKNLDVPKLEPCNLLKKLASQGNPPLQEWRRLGRLQTSHL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttccggacacgcccccaagccctcaagtgcccttcgccacggcggcccgcaca
ctgcgcacgcgcgaaatgctccctaagccggtgatagaaggcttacttaacagcctgagg
aaagccgaaaccgacctggctgtgaaatccatcgtcatctgtggagcagatggaaagttc
tctgcagagaatccatcaatcagtgagcgcttgttaagtggctatggcacctcaagtacc
gtgctgggaagtgaagaaacagtgactgaaacagaagaatctaagggcctcgaggagctg
agagatacagtatttacacaggctcaagttggtctcccagaggtcaccattggacttctc
cctggagcacaaggtacccagcttctccccagactcattggagtgcctgctgcccttgac
ctgatcacctcagggagacacattctggcttcggaggcgctcaaactggggatactggac
aaaattgtgaacgccgatccagtcgaggaagccatcaaattggccaaaagtgtctcaggt
cagtccataagttctcgaagactcataatgaggcaggtgcagaacctgccaaatatggac
atcattttccaggaaactctgcttaggatgaggaaacagtacccagggtgtatttctcgg
gaagcctgtgtccaagccgtccaggccgctgtccaatacccctacttggaagggaaggag
agagagaaggagctgttcctgtaccttgtgacttcaggacaagctcgagccctgcagtat
gctttctttgctgagagaattgtgagaaaatggtcaactccttccggggcatcatggaag
acatcctcagggaagcccatctcatccgcagcagtagtgggtctgggaacaatggggaga
ggtatcgtcatctctctgatcatggccggcatccctgtgattgccatggaacaggacgag
cagcagctggatggggccaagaggatgatcttcttcgttttggaacaagaagcctctaag
cggaaggggagcggccaggagtggaggcagcccaggctccggttcaccacctccctggac
gaggttgcaggcacggacttggtgatcgaagccgtctttgaggagatggggctgaagaag
caggtgtttggcagtctgtcggccagatgccagccctcggccctgctgtgcaccaacacc
tcgtgcctggacgtcgacgagctcgccctgtgcacgggccgccctcaccaggtcatcggc
acccacttcttcgcccccgctcaccggatgaagctgctggaggtcatccccagccgatac
tcctcccccacgaccatcgccaccgtcatgggcctggccaagacccttcagaaggttggg
gtcgtcgtcggaaactgcctgggatttgtcggcaatcggatgctgatggctttcaacgag
cagaattatttcttattggaagatgggagccggccggaggaaatcgatcaggtgctggag
gagtttggtttcagaatgggccctttccgggtggcggatctgtctgggctggacgtgggc
tggaaatcacgcaaaggtcagggcctcacgggacccttggtggccccagggacgcctctg
cgccaacgcggcggccgacggtattgcccgattcccgacatcctctgtgaacatggaaga
ctgggccagaagaccggcagaggctggtaccagtacgacaaaccgacaggctggagacac
cagcccgacccctggctctctaagttcttgtctgagtaccggcgggagcacgagatcgag
ccccgggccataacctccgaggagatcctggagcgctgcgtgtactccctcatcaatgaa
ggctttcgcctcctggaggaaggcatggccgcgggccccgagcacatcgacgtgatttat
aacaatggctacggatggccgaggcacaggggagggcccatgttctacgcttccacggtg
ggactccccacggtggcggagagattacagaagtattaccagaagaatctggacgtcccc
aagctggagccctgcaaccttctgaaaaagctggcttcccaggggaaccccccacttcag
gaatggcggcgcttggggcggctgcagaccagccacctgtga

DBGET integrated database retrieval system