KEGG   Sarcophilus harrisii (Tasmanian devil): 100913352Help
Entry
100913352         CDS       T02286                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100913352 (TGFBR2)
   04350 TGF-beta signaling pathway
    100913352 (TGFBR2)
   04390 Hippo signaling pathway
    100913352 (TGFBR2)
   04068 FoxO signaling pathway
    100913352 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100913352 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100913352 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    100913352 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    100913352 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100913352 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100913352 (TGFBR2)
   05210 Colorectal cancer
    100913352 (TGFBR2)
   05212 Pancreatic cancer
    100913352 (TGFBR2)
   05220 Chronic myeloid leukemia
    100913352 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100913352 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100913352 (TGFBR2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100913352 (TGFBR2)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100913352 (TGFBR2)
Enzyme-linked receptors [BR:shr01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100913352 (TGFBR2)
Cytokine receptors [BR:shr04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100913352 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 506 aa AA seqDB search
MHSFKIPFWCLLVNSTPSILHPVTEENGALKTALLCKFCDVQATNCTSNDRNCLSFCDIT
SICEQAHEICVAVWYIQTGEESNEDGQVCLQEVFDHSELLAIISKVTIISLLPPVGIAIA
VIVIFYCYRVHRRRKLSTTWESSKSRKLVECSDRCAMMMDDDRSDISSTCANNLNHNTEL
LPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKEIFSDINLKH
ENILQFLTAEERKMDLGKQYWLITAFHARGNLQEYLTRHVISWEDLWKLGSSLSRGIAHL
HSDHTPCGRPKTAIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGT
ARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNEIGEVKEYEPPFGSKVREH
PCVESMKDNVLRDRGRPEIPNTWLSHRGIQMVCETLAECWDHDPEARLTAQCVAERFEEL
SDLDRLSGRSCSEEKIPEDCSLSTPK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcattcatttaaaataccattttggtgtctcttagtaaactctactcctagcatcctc
catccggtcactgaggaaaatggtgcattaaagaccgcgctcctctgcaagttctgtgat
gtacaagcaaccaactgcaccagcaatgacaggaactgcttaagtttctgcgacatcact
tcgatctgtgaacaagcccatgaaatctgcgtggctgtgtggtatattcaaactggagag
gagagcaatgaggatgggcaggtctgtctgcaggaagtttttgaccactccgagcttttg
gccatcatctccaaagtgaccatcatcagcctccttccgcccgtgggcatcgctatcgcc
gtgattgtcatcttctactgctaccgggtacaccgcaggagaaagctgagtaccacctgg
gagagcagcaagtcgcggaagctggtagagtgcagcgaccgctgtgccatgatgatggat
gacgaccgctcggacataagctccacctgcgccaacaacctcaatcacaacacagagctg
ctgcccatcgagctggacaccctggtgggcaaggggcgctttgctgaggtctacaaggcc
aagctgaaacagaacacttccgagcagttcgagacggtggcggtcaagatctttccctat
gaggaatatgcctcctggaagactgaaaaggagatcttctcggacatcaacctcaagcat
gagaacatccttcagttcctgacggcggaggagcggaagatggacttgggaaagcagtat
tggctcatcaccgccttccatgccaggggcaacctgcaggagtacctcaccaggcacgtc
atcagctgggaggacctgtggaagctgggcagctccctgtccaggggcatcgcccatctc
catagcgaccacactccctgcgggagaccaaaaacagccatcgttcacagagacctgaag
agctccaacatcctagtgaaaaacgacctgacctgctgcctctgtgactttgggctgtcc
ctgagattggacccgaccctctctgtggatgacttggccaacagcgggcaggttgggaca
gcaagatatatggctcctgaggttttggaatccagaatgaacttggaaaatatggagtcc
ttcaagcaaacagatgtatattccatggccctggttctctgggaaatgacgtctcgctgc
aatgagataggagaggtcaaggaatatgagccgccatttggttccaaagtgagagagcat
ccctgcgtcgagagcatgaaggacaacgtgctgagagaccggggtcggcctgagatcccc
aacacgtggctcagccaccgaggtatacagatggtttgtgagactttggccgagtgctgg
gaccacgatccagaagcacggctgaccgcccagtgcgtggccgaacgttttgaagaactg
agcgatctggatcggctgtcggggagaagctgttcagaggagaagatccctgaggactgc
tccctgagcacccccaagtaa

DBGET integrated database retrieval system