KEGG   Sarcophilus harrisii (Tasmanian devil): 100913352Help
Entry
100913352         CDS       T02286                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:shr04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:shr04390]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:shr04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:shr04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:shr04144]
Cellular Processes; Cell communication; Adherens junction [PATH:shr04520]
Organismal Systems; Development; Osteoclast differentiation [PATH:shr04380]
Human Diseases; Cancers; Pathways in cancer [PATH:shr05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:shr05202]
Human Diseases; Cancers; Colorectal cancer [PATH:shr05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:shr05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:shr05220]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:shr05166]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:shr05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 506 aa AA seqDB search
MHSFKIPFWCLLVNSTPSILHPVTEENGALKTALLCKFCDVQATNCTSNDRNCLSFCDIT
SICEQAHEICVAVWYIQTGEESNEDGQVCLQEVFDHSELLAIISKVTIISLLPPVGIAIA
VIVIFYCYRVHRRRKLSTTWESSKSRKLVECSDRCAMMMDDDRSDISSTCANNLNHNTEL
LPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKEIFSDINLKH
ENILQFLTAEERKMDLGKQYWLITAFHARGNLQEYLTRHVISWEDLWKLGSSLSRGIAHL
HSDHTPCGRPKTAIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGT
ARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNEIGEVKEYEPPFGSKVREH
PCVESMKDNVLRDRGRPEIPNTWLSHRGIQMVCETLAECWDHDPEARLTAQCVAERFEEL
SDLDRLSGRSCSEEKIPEDCSLSTPK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcattcatttaaaataccattttggtgtctcttagtaaactctactcctagcatcctc
catccggtcactgaggaaaatggtgcattaaagaccgcgctcctctgcaagttctgtgat
gtacaagcaaccaactgcaccagcaatgacaggaactgcttaagtttctgcgacatcact
tcgatctgtgaacaagcccatgaaatctgcgtggctgtgtggtatattcaaactggagag
gagagcaatgaggatgggcaggtctgtctgcaggaagtttttgaccactccgagcttttg
gccatcatctccaaagtgaccatcatcagcctccttccgcccgtgggcatcgctatcgcc
gtgattgtcatcttctactgctaccgggtacaccgcaggagaaagctgagtaccacctgg
gagagcagcaagtcgcggaagctggtagagtgcagcgaccgctgtgccatgatgatggat
gacgaccgctcggacataagctccacctgcgccaacaacctcaatcacaacacagagctg
ctgcccatcgagctggacaccctggtgggcaaggggcgctttgctgaggtctacaaggcc
aagctgaaacagaacacttccgagcagttcgagacggtggcggtcaagatctttccctat
gaggaatatgcctcctggaagactgaaaaggagatcttctcggacatcaacctcaagcat
gagaacatccttcagttcctgacggcggaggagcggaagatggacttgggaaagcagtat
tggctcatcaccgccttccatgccaggggcaacctgcaggagtacctcaccaggcacgtc
atcagctgggaggacctgtggaagctgggcagctccctgtccaggggcatcgcccatctc
catagcgaccacactccctgcgggagaccaaaaacagccatcgttcacagagacctgaag
agctccaacatcctagtgaaaaacgacctgacctgctgcctctgtgactttgggctgtcc
ctgagattggacccgaccctctctgtggatgacttggccaacagcgggcaggttgggaca
gcaagatatatggctcctgaggttttggaatccagaatgaacttggaaaatatggagtcc
ttcaagcaaacagatgtatattccatggccctggttctctgggaaatgacgtctcgctgc
aatgagataggagaggtcaaggaatatgagccgccatttggttccaaagtgagagagcat
ccctgcgtcgagagcatgaaggacaacgtgctgagagaccggggtcggcctgagatcccc
aacacgtggctcagccaccgaggtatacagatggtttgtgagactttggccgagtgctgg
gaccacgatccagaagcacggctgaccgcccagtgcgtggccgaacgttttgaagaactg
agcgatctggatcggctgtcggggagaagctgttcagaggagaagatccctgaggactgc
tccctgagcacccccaagtaa

DBGET integrated database retrieval system