KEGG   Sarcophilus harrisii (Tasmanian devil): 100913352Help
Entry
100913352         CDS       T02286                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04144  Endocytosis
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04380  Osteoclast differentiation
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04659  Th17 cell differentiation
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05142  Chagas disease (American trypanosomiasis)
shr05166  HTLV-I infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Module
shr_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100913352 (TGFBR2)
   04350 TGF-beta signaling pathway
    100913352 (TGFBR2)
   04390 Hippo signaling pathway
    100913352 (TGFBR2)
   04068 FoxO signaling pathway
    100913352 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100913352 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100913352 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100913352 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100913352 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100913352 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    100913352 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    100913352 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100913352 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100913352 (TGFBR2)
   05210 Colorectal cancer
    100913352 (TGFBR2)
   05212 Pancreatic cancer
    100913352 (TGFBR2)
   05225 Hepatocellular carcinoma
    100913352 (TGFBR2)
   05226 Gastric cancer
    100913352 (TGFBR2)
   05220 Chronic myeloid leukemia
    100913352 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913352 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100913352 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100913352 (TGFBR2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100913352 (TGFBR2)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: TKL group
  TGFBR2 family [OT]
   100913352 (TGFBR2)
Cytokine receptors [BR:shr04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100913352 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100913352
NCBI-ProteinID: XP_023360987
Position
5
AA seq 418 aa AA seqDB search
MTKEVFDHSELLAIISKVTIISLLPPVGIAIAVIVIFYCYRVHRRRKLSTTWESSKSRKL
VECSDRCAMMMDDDRSDISSTCANNLNHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSE
QFETVAVKIFPYEEYASWKTEKEIFSDINLKHENILQFLTAEERKMDLGKQYWLITAFHA
RGNLQEYLTRHVISWEDLWKLGSSLSRGIAHLHSDHTPCGRPKTAIVHRDLKSSNILVKN
DLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENMESFKQTDVYS
MALVLWEMTSRCNEIGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPNTWLSHRG
IQMVCETLAECWDHDPEARLTAQCVAERFEELSDLDRLSGRSCSEEKIPEDCSLSTPK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaagtttttgaccactccgagcttttggccatcatctccaaagtgaccatc
atcagcctccttccgcccgtgggcatcgctatcgccgtgattgtcatcttctactgctac
cgggtacaccgcaggagaaagctgagtaccacctgggagagcagcaagtcgcggaagctg
gtagagtgcagcgaccgctgtgccatgatgatggatgacgaccgctcggacataagctcc
acctgcgccaacaacctcaatcacaacacagagctgctgcccatcgagctggacaccctg
gtgggcaaggggcgctttgctgaggtctacaaggccaagctgaaacagaacacttccgag
cagttcgagacggtggcggtcaagatctttccctatgaggaatatgcctcctggaagact
gaaaaggagatcttctcggacatcaacctcaagcatgagaacatccttcagttcctgacg
gcggaggagcggaagatggacttgggaaagcagtattggctcatcaccgccttccatgcc
aggggcaacctgcaggagtacctcaccaggcacgtcatcagctgggaggacctgtggaag
ctgggcagctccctgtccaggggcatcgcccatctccatagcgaccacactccctgcggg
agaccaaaaacagccatcgttcacagagacctgaagagctccaacatcctagtgaaaaac
gacctgacctgctgcctctgtgactttgggctgtccctgagattggacccgaccctctct
gtggatgacttggccaacagcgggcaggttgggacagcaagatatatggctcctgaggtt
ttggaatccagaatgaacttggaaaatatggagtccttcaagcaaacagatgtatattcc
atggccctggttctctgggaaatgacgtctcgctgcaatgagataggagaggtcaaggaa
tatgagccgccatttggttccaaagtgagagagcatccctgcgtcgagagcatgaaggac
aacgtgctgagagaccggggtcggcctgagatccccaacacgtggctcagccaccgaggt
atacagatggtttgtgagactttggccgagtgctgggaccacgatccagaagcacggctg
accgcccagtgcgtggccgaacgttttgaagaactgagcgatctggatcggctgtcgggg
agaagctgttcagaggagaagatccctgaggactgctccctgagcacccccaagtaa

DBGET integrated database retrieval system