KEGG   Sarcophilus harrisii (Tasmanian devil): 100913363Help
Entry
100913363         CDS       T02286                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100913363
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100913363
   00982 Drug metabolism - cytochrome P450
    100913363
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100913363
   05225 Hepatocellular carcinoma
    100913363
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100913363
  Drug resistance
   01524 Platinum drug resistance
    100913363
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100913363
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100913363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 241 aa AA seqDB search
MSQNSSRSLGKGSSPPGPVPAGIIRVYSMRFCPFAQRTLLVLKAKGIKHEIININLKNKP
DWFFNKNPFGLVPVLETSQGQLIYESVITCEYLDEAYPGKLFPEDPYKKAFQKMILESFS
KVPLLSKESLVAVRNGEDCSAQKAELRMVFSNLEEILFRQKTTFFGGDTVSMIDYLIWPW
FERLGSFEIADCVNHTLKLKLWIAAMKKDPTVSALLVEEKTLKNFIHLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaactcaagtaggagcctggggaaaggaagctctcccccgggtcctgtacca
gctggaatcatccgtgtttacagcatgagattctgtccctttgctcagagaactctgctt
gtcctgaaggccaaaggaatcaagcatgaaattatcaacatcaatctgaaaaacaaacct
gattggttctttaataagaatccctttggtctagtaccagttctggagaccagtcagggt
caactaatctatgaatctgttatcacttgtgagtacttagatgaagcctatccagggaag
ttgtttccagaagatccctataagaaagcttttcaaaagatgattttggagtcgttctct
aaggtaccacttttgtctaaggaatctttggtagctgtaaggaatggagaagattgctct
gctcagaaagcagaactccgtatggtgttcagcaatctggaggagattctttttcgtcag
aagacaactttctttggtggcgacactgtatccatgatcgattacctcatttggccctgg
tttgaacgtctgggatcatttgagatagcagactgtgtgaaccacaccttgaaacttaag
ctctggatagcagccatgaagaaggatcctacagtatcagccctccttgtagaagagaaa
actcttaaaaatttcatacatctctatctgcagaatagtcctgaggcctgtgattatggt
ctatga

DBGET integrated database retrieval system