KEGG   Sarcophilus harrisii (Tasmanian devil): 100913363Help
Entry
100913363         CDS       T02286                                 

Definition
glutathione S-transferase omega-1-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100913363
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100913363
   00982 Drug metabolism - cytochrome P450
    100913363
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100913363
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100913363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 241 aa AA seqDB search
MSQNSSRSLGKGSSPPGPVPAGIIRVYSMRFCPFAQRTLLVLKAKGIKHEIININLKNKP
DWFFNKNPFGLVPVLETSQGQLIYESVITCEYLDEAYPGKLFPEDPYKKAFQKMILESFS
KVPLLSKESLVAVRNGEDCSAQKAELRMVFSNLEEILFRQKTTFFGGDTVSMIDYLIWPW
FERLGSFEIADCVNHTLKLKLWIAAMKKDPTVSALLVEEKTLKNFIHLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaactcaagtaggagcctggggaaaggaagctctcccccgggtcctgtacca
gctggaatcatccgtgtttacagcatgagattctgtccctttgctcagagaactctgctt
gtcctgaaggccaaaggaatcaagcatgaaattatcaacatcaatctgaaaaacaaacct
gattggttctttaataagaatccctttggtctagtaccagttctggagaccagtcagggt
caactaatctatgaatctgttatcacttgtgagtacttagatgaagcctatccagggaag
ttgtttccagaagatccctataagaaagcttttcaaaagatgattttggagtcgttctct
aaggtaccacttttgtctaaggaatctttggtagctgtaaggaatggagaagattgctct
gctcagaaagcagaactccgtatggtgttcagcaatctggaggagattctttttcgtcag
aagacaactttctttggtggcgacactgtatccatgatcgattacctcatttggccctgg
tttgaacgtctgggatcatttgagatagcagactgtgtgaaccacaccttgaaacttaag
ctctggatagcagccatgaagaaggatcctacagtatcagccctccttgtagaagagaaa
actcttaaaaatttcatacatctctatctgcagaatagtcctgaggcctgtgattatggt
ctatga

DBGET integrated database retrieval system