KEGG   Sarcophilus harrisii (Tasmanian devil): 100913510Help
Entry
100913510         CDS       T02286                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:shr05203]
Human Diseases; Substance dependence; Alcoholism [PATH:shr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 379 aa AA seqDB search
MQEAEEPAPPPRQPPVPPVYIYSPEYVRTCDSLAKVPKRASMVHSLIEAYELLKEMRVVK
PKVASMEEMASFHTDAYLQHLQKVSEEGDDEHPDSVEFGLGYDCPSTEGIFDYAAAVGGA
TITAAQCLIDGKCNIAINWAGGWHHAKKDEASGFCYLNDAVLGILHLRRKFDRILYIDLD
LHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIRDE
KYYQVCKSVLKEVYVAFNPKAVVLQLGADTIAGDPMCSFNLTPVGLGKCLKYILQWQLAT
LILGGGGYHLANTARCWTYLTGVILGRTLSSEIPDHEFFTEYGPDYVLEITPSCRPDRNE
LHQIQHILSRIMGNMKHVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggcggaggagcccgcgccccctccgcggcagccgcctgtgcccccagtctac
atctatagccccgagtacgtccgaacttgtgactcgctggccaaggtgcccaagcgggcc
agcatggtgcactccctgatcgaagcctatgagctgctgaaggaaatgagggtagtgaag
cccaaggtggcttccatggaggagatggccagcttccacacggatgcctatctgcagcac
ctccagaaggtcagtgaggaaggggatgacgagcatcctgactccgtggaattcggcctg
ggctacgactgccccagcacggagggcatatttgattatgcggctgcagtggggggggcc
accatcacggcggcccaatgcctgattgatggaaaatgtaacatagccattaactgggct
ggaggttggcaccatgccaagaaagatgaagcttcaggcttctgttacctcaatgatgct
gtcctagggatcctgcatttgagaaggaagtttgaccgcattctgtacattgacttggac
cttcaccatggagatggcgtcgaagatgctttcagtttcacttctaaagtcatgaccgtg
tctctgcacaaattttctccagggttttttccaggaactggcgatgtatctgatgtgggc
ctcgggaagggaaggtattacagcgtcaacgtgccgatccaggatggcatacgagatgaa
aagtattaccaggtctgcaaaagtgtcctcaaggaggtctatgtagccttcaatcccaaa
gctgtggttttacaattaggagctgacactatagctggggacccaatgtgttcatttaac
ttgactcctgtgggacttggcaagtgtcttaagtacatccttcagtggcagttggccacc
ctcatcttgggaggaggaggctaccaccttgccaacacagcccgatgctggacatacttg
actggggtcatcctggggagaacactctcgtctgagattccagatcatgaatttttcact
gaatatggcccggattatgtgttggaaatcacccccagctgccggcctgaccgcaatgag
ttgcaccaaatccagcatatcctgagtcgtattatggggaacatgaagcatgtggtttag

DBGET integrated database retrieval system