KEGG   Sarcophilus harrisii (Tasmanian devil): 100913513Help
Entry
100913513         CDS       T02286                                 

Gene name
CACNG8
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 8
  KO
K04873  
voltage-dependent calcium channel gamma-8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100913513 (CACNG8)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100913513 (CACNG8)
  Circulatory system
   04260 Cardiac muscle contraction
    100913513 (CACNG8)
   04261 Adrenergic signaling in cardiomyocytes
    100913513 (CACNG8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100913513 (CACNG8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100913513 (CACNG8)
   05414 Dilated cardiomyopathy (DCM)
    100913513 (CACNG8)
Ion channels [BR:shr04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   100913513 (CACNG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 268 aa AA seqDB search
MGERGVGGEEQLRAELGDKNSASRLGRVTIAFNLSFLMCHKTHAPADHGSPLTPCSPARL
PLRCRRQPPGGPSFRLESLKRWTEARGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWL
YTRAFICNTTNLSASASEDPPARGPGGVAEKRDPGGLTHSGLWRICCLEGLKRGVCVKIN
HFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGIL
FVAAGEGRGGGTGRGPQQRGGEGPRVSG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacggggagtggggggagaggagcagctgcgggcggaacttggagacaagaac
tcggcttccagactgggtcgagtcacaatcgctttcaacctcagtttcctcatgtgtcat
aaaacgcatgcccccgctgaccatggcagcccgctgaccccgtgctcgcccgcccgcctg
cctcttcgctgccggcgccagccccccgggggtccctccttcagactggagtccctgaag
cgctggacagaggctcggggcctgtggtgtgagaagggcgtccaggtgctgctgaccacg
gttggtgccttcgccgccttcggcctcatgaccatcgccatcagcaccgactactggctc
tacaccagggccttcatctgcaacaccaccaacctgagcgcctctgcctccgaggacccc
ccggcccgagggcccggcggggtggcggagaagagggaccctggggggctgacccactcg
ggcctctggaggatctgctgcctggaaggactgaagcggggtgtctgtgtgaagattaat
cacttcccagaagacacagattacgaccatgacagtgcagagtacctactccgtgtggtc
cgagcatccagcatcttccccattctcagcgccatcctcctgctgctggggggcgtgtgt
gtggctgcctctcgagtctacaagtccaagaggaacatcatcctgggggccggcattctc
tttgtagccgctggtgagggccgaggagggggcacggggcggggcccgcaacagcgcgga
ggggaggggcctagagtctcgggatga

DBGET integrated database retrieval system