KEGG   Sarcophilus harrisii (Tasmanian devil): 100913513Help
Entry
100913513         CDS       T02286                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-8 subunit
  KO
K04873  voltage-dependent calcium channel gamma-8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04260  Cardiac muscle contraction
shr04261  Adrenergic signaling in cardiomyocytes
shr04921  Oxytocin signaling pathway
shr05410  Hypertrophic cardiomyopathy (HCM)
shr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
shr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100913513
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100913513
  Circulatory system
   04260 Cardiac muscle contraction
    100913513
   04261 Adrenergic signaling in cardiomyocytes
    100913513
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100913513
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100913513
   05414 Dilated cardiomyopathy (DCM)
    100913513
Ion channels [BR:shr04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   100913513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 100913513
NCBI-ProteinID: XP_012402336
Position
3
AA seq 268 aa AA seqDB search
MGERGVGGEEQLRAELGDKNSASRLGRVTIAFNLSFLMCHKTHAPADHGSPLTPCSPARL
PLRCRRQPPGGPSFRLESLKRWTEARGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWL
YTRAFICNTTNLSASASEDPPARGPGGVAEKRDPGGLTHSGLWRICCLEGLKRGVCVKIN
HFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGIL
FVAAGEGRGGGTGRGPQQRGGEGPRVSG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacggggagtggggggagaggagcagctgcgggcggaacttggagacaagaac
tcggcttccagactgggtcgagtcacaatcgctttcaacctcagtttcctcatgtgtcat
aaaacgcatgcccccgctgaccatggcagcccgctgaccccgtgctcgcccgcccgcctg
cctcttcgctgccggcgccagccccccgggggtccctccttcagactggagtccctgaag
cgctggacagaggctcggggcctgtggtgtgagaagggcgtccaggtgctgctgaccacg
gttggtgccttcgccgccttcggcctcatgaccatcgccatcagcaccgactactggctc
tacaccagggccttcatctgcaacaccaccaacctgagcgcctctgcctccgaggacccc
ccggcccgagggcccggcggggtggcggagaagagggaccctggggggctgacccactcg
ggcctctggaggatctgctgcctggaaggactgaagcggggtgtctgtgtgaagattaat
cacttcccagaagacacagattacgaccatgacagtgcagagtacctactccgtgtggtc
cgagcatccagcatcttccccattctcagcgccatcctcctgctgctggggggcgtgtgt
gtggctgcctctcgagtctacaagtccaagaggaacatcatcctgggggccggcattctc
tttgtagccgctggtgagggccgaggagggggcacggggcggggcccgcaacagcgcgga
ggggaggggcctagagtctcgggatga

DBGET integrated database retrieval system