KEGG   Sarcophilus harrisii (Tasmanian devil): 100913672Help
Entry
100913672         CDS       T02286                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100913672 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100913672 (CYSLTR2)
G protein-coupled receptors [BR:shr04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100913672 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 446 aa AA seqDB search
MTEIRETQTLHNAFTTTVATVTTATATAAAAAAAATTTINTITAINLHLHWALKFIKHLT
HSDELFSATEVIDIHLENLTIIRGLIFPYALVMTSHENFQTRSGMPSKPLLSILPVTTAE
MEPNGSFRGTQENCMVDDFKRNFYPGVYLVVFVLGALGNGFSIFIFLQPSKKPKSVNVFM
LNLAVSDLLFVCTLPFRADYYLRGSHWVFGETACRIMSYSFHANMYVSVYFLTVLSIVRF
LATVCPFRLLHVTSLRTAWSLCAAIWVLVLAPSGLLLSSGTSKNGKRASCLEMNLSKITR
LRILNHVVMVVGFALPFCTLTICYLLMIKSLLRLKVPKSNARISHKKALITVTIALILFV
LCFLPYHILRTLYLIQWREGRCNEQLHKAVIVTMAMAVANSCLNPLLYYFAGENFKQRLR
AVFKKGCMQKEMHQSCLYMAKQTMHE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattagagagactcaaacactacataatgcttttactactactgttgctact
gttactacagctacagctacagctgctgctgctgctgctgctgctactactactattaat
actattactgctataaatttgcatttacattgggctttaaaatttataaagcacctcaca
cattctgatgagcttttctcagcaacagaagttatagacattcacttggaaaatttgaca
ataatcagaggattaattttcccttatgctcttgttatgacttctcatgaaaatttccag
acaagatccgggatgcccagcaaacctctcctctctatactgccggttaccacagcagag
atggaaccaaatggcagcttcaggggcacccaggagaactgcatggtggatgacttcaag
agaaacttttatcctggagtctacctggtcgtatttgtcctgggggccctgggcaatggc
ttttccatattcattttcctgcaaccttctaaaaagcccaagtcggtgaacgtgttcatg
ctgaacttggctgtttcggacttgctctttgtgtgcacgctgcccttcagggcggactat
tacctgcggggctctcactgggtgtttggcgaaacagcgtgcaggatcatgtcctattcc
ttccacgccaacatgtatgtcagcgtttacttcctgaccgtcctgagcatcgtccgtttc
ctggccaccgtgtgtcccttcaggctcctgcatgtgaccagcctcaggacggcctggagc
ctatgtgcggccatctgggtcctggtcctggccccctcaggcctgcttctgagcagcgga
acctccaagaacggaaagagggccagctgcttggagatgaaccttagcaagatcaccagg
ctgcggatcctgaaccacgtggtgatggtggtgggcttcgccctgcctttctgcactctg
accatctgctatctgctgatgatcaagagtttgctccggctcaaggttcccaagtctaac
gcccgaatctctcacaagaaggcgctgatcacggtcaccatcgccctgattctctttgtg
ctgtgtttcctgccctatcacatcctcaggactctctacctaattcagtggagggagggc
aggtgcaacgaacagctgcacaaggctgtcatcgtcaccatggccatggccgtggctaat
agttgccttaaccctttgctttactattttgccggagagaattttaaacagaggctaaga
gcggtattcaaaaagggatgtatgcagaaagaaatgcaccagtcctgtttgtacatggcc
aaacaaacgatgcacgagtaa

DBGET integrated database retrieval system