KEGG   Sarcophilus harrisii (Tasmanian devil): 100913672Help
Entry
100913672         CDS       T02286                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:shr04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:shr04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 446 aa AA seqDB search
MTEIRETQTLHNAFTTTVATVTTATATAAAAAAAATTTINTITAINLHLHWALKFIKHLT
HSDELFSATEVIDIHLENLTIIRGLIFPYALVMTSHENFQTRSGMPSKPLLSILPVTTAE
MEPNGSFRGTQENCMVDDFKRNFYPGVYLVVFVLGALGNGFSIFIFLQPSKKPKSVNVFM
LNLAVSDLLFVCTLPFRADYYLRGSHWVFGETACRIMSYSFHANMYVSVYFLTVLSIVRF
LATVCPFRLLHVTSLRTAWSLCAAIWVLVLAPSGLLLSSGTSKNGKRASCLEMNLSKITR
LRILNHVVMVVGFALPFCTLTICYLLMIKSLLRLKVPKSNARISHKKALITVTIALILFV
LCFLPYHILRTLYLIQWREGRCNEQLHKAVIVTMAMAVANSCLNPLLYYFAGENFKQRLR
AVFKKGCMQKEMHQSCLYMAKQTMHE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattagagagactcaaacactacataatgcttttactactactgttgctact
gttactacagctacagctacagctgctgctgctgctgctgctgctactactactattaat
actattactgctataaatttgcatttacattgggctttaaaatttataaagcacctcaca
cattctgatgagcttttctcagcaacagaagttatagacattcacttggaaaatttgaca
ataatcagaggattaattttcccttatgctcttgttatgacttctcatgaaaatttccag
acaagatccgggatgcccagcaaacctctcctctctatactgccggttaccacagcagag
atggaaccaaatggcagcttcaggggcacccaggagaactgcatggtggatgacttcaag
agaaacttttatcctggagtctacctggtcgtatttgtcctgggggccctgggcaatggc
ttttccatattcattttcctgcaaccttctaaaaagcccaagtcggtgaacgtgttcatg
ctgaacttggctgtttcggacttgctctttgtgtgcacgctgcccttcagggcggactat
tacctgcggggctctcactgggtgtttggcgaaacagcgtgcaggatcatgtcctattcc
ttccacgccaacatgtatgtcagcgtttacttcctgaccgtcctgagcatcgtccgtttc
ctggccaccgtgtgtcccttcaggctcctgcatgtgaccagcctcaggacggcctggagc
ctatgtgcggccatctgggtcctggtcctggccccctcaggcctgcttctgagcagcgga
acctccaagaacggaaagagggccagctgcttggagatgaaccttagcaagatcaccagg
ctgcggatcctgaaccacgtggtgatggtggtgggcttcgccctgcctttctgcactctg
accatctgctatctgctgatgatcaagagtttgctccggctcaaggttcccaagtctaac
gcccgaatctctcacaagaaggcgctgatcacggtcaccatcgccctgattctctttgtg
ctgtgtttcctgccctatcacatcctcaggactctctacctaattcagtggagggagggc
aggtgcaacgaacagctgcacaaggctgtcatcgtcaccatggccatggccgtggctaat
agttgccttaaccctttgctttactattttgccggagagaattttaaacagaggctaaga
gcggtattcaaaaagggatgtatgcagaaagaaatgcaccagtcctgtttgtacatggcc
aaacaaacgatgcacgagtaa

DBGET integrated database retrieval system