KEGG   Sarcophilus harrisii (Tasmanian devil): 100913876Help
Entry
100913876         CDS       T02286                                 

Gene name
USP15
Definition
ubiquitin specific peptidase 15
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100913876 (USP15)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100913876 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 983 aa AA seqDB search
MAEGGAADLDTQQSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQMLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYL
VRMDPLTKPMQYKVVVPKIGNILDLCTALSTLSGVPADKMIVTDIYNHRFHRIFAMDENL
NSIMERDDIYVFEITINRTEDTEQVIIPVCLREKYRHTGYSHHSGSSLFGQPFLMAVPRN
NTEEKLYNLLLLRMCRYVKTSTETEETEGSLHCCKDQNINGNGPNGIHEECSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLLMGHKKRLFTFQFNNL
GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPELKKRYFDDNAAEDFEKHESVEYK
PPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFS
YSRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNK
DDGKWYYFDDTSVSTGSEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKQGASAATGIP
LESDEDSNENDNDIENENCMHTN
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaggagcggcggatctggacacccagcagtccgacatcgctacgttgctc
aaaacctcgctccggaaaggggacacctggtatttagtggatagccgttggttcaaacag
tggaaaaaatatgttgggtttgacagttgggacaaataccagatgggagatcaaaatgtg
taccctggtcccattgataattctggactccttaaagatggtgatgctcagtcccttaag
gaacatcttattgatgaattggattatatcttattgccaactgaaggctggaataaactt
gtcagctggtacacattgatggaaggtcaggaaccaatagcacgcaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctaacagaattaaagctgtgcgaa
aatggaaatatgaacaatgttgtaacacgaagatttagcaaagctgacacaatagataca
attgaaaaagaaataagaaaaatcttcaatattccagatgaaaaagagaccagattatgg
aacaaatacatgagtaatacatttgagccactaaataagccagacagtaccattcaggat
gctggtttatatcaaggacagatgctagtaatagagcagaaaaatgaagatggaacgtgg
ccaagaggtccttcaactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccttcatctctatcaaataattataacaacatcaacaacagaaatgtgaaaaat
tcaaattattgtctcccatcatacactgcttataagaactatgattattcagagccagga
agaaacaatgaacagcctggcctatgtggcctaagtaacttgggaaatacgtgtttcatg
aattcagctattcagtgtttgagcaacactcctcctcttactgagtatttcctcaatgat
aaatatcaagaagaattgaattttgacaatcccttaggaatgagaggtgaaatagcgaaa
tcttatgctgagctcatcaagcaaatgtggtctggaaaatacagctatgtcaccccaaga
gccttcaagacacaagtaggacgttttgcacctcagttttctgggtatcaacagcaagac
tgtcaagaattactagctttcctcttagatggtctacatgaagatttgaatagaattagg
aaaaaaccttatattcagctgaaggatgctgatggaaggcctgacaaggtggttgctgaa
gaagcctgggaaaaccatttaaagagaaatgactctatcatagtagatatatttcatggc
cttttcaaatcaaccctagtttgtcctgaatgtgctaagatttcagtaacatttgatcct
ttttgttacttgacacttccactgcctatgaaaaaagagcgtaccttggaagtttactta
gttagaatggatccacttaccaaacctatgcagtacaaagtagttgttcccaaaattgga
aacatactagatctttgcacagctctatccactttgtcaggagtaccagctgataagatg
atagttactgatatctacaatcacagatttcacagaatatttgctatggatgaaaatctt
aatagtattatggaacgggatgatatttatgtatttgaaattaccatcaatagaacagaa
gatactgaacaagtcataattcctgtttgtttaagagaaaaatacagacacacaggttat
agccaccacagtggttcatcactctttggccaaccttttcttatggcagtacctagaaat
aatactgaagaaaaactctacaatcttttattattgaggatgtgtcgttatgtaaaaaca
tctactgaaactgaagaaacagaaggatccctacattgctgtaaggaccaaaatattaat
gggaatggcccaaatggaatacatgaagaatgttccccaagtgaaatggaaacagatgag
ccagatgatgaatccagccaggatcaagaacttccttcagagaatgagaatagtcagtct
gaagattcagttggaggagataatgattctgagaatggattatgtactgaagaaacttgc
aaaggtcaacttctcatgggacacaaaaagcgattatttacattccagttcaacaactta
ggcaatacagatatcaattacatcaaagatgatactagacatattagatttgatgacaga
cagcttagactagatgaaagatctttccttgctttggattgggatcctgaattgaaaaaa
agatactttgatgataatgcagctgaggattttgaaaaacatgaaagtgtggaatataaa
cctcccaaaaaaccttttgtgaaattaaaagattgcattgaactttttaccacaaaagaa
aagctaggtgctgaagatccttggtactgtccaaattgtaaagaacatcagcaggctaca
aaaaaattagatttatggtcactgcctcctgtactggtggtacatcttaaacgtttttct
tacagcagatacatgagggataagttggacacattagttgattttcctattaatgacttg
gatatgtcagaattccttattaatccaaatgcagggccttgccgctacaatttgattgct
gtgtccaaccactatggaggaatgggaggagggcactatactgctttcgctaaaaataaa
gatgatggaaaatggtactattttgatgacactagtgtctcaactggttctgaagaccaa
attgtgtccaaagcagcatatgtgctcttctaccagagacaggacactttcagtggaact
ggcttttttccccttgaccgagaaactaaacaaggtgcttcagctgccacaggcatccca
ttagagagtgacgaagatagtaatgagaatgacaatgatatagaaaatgaaaattgtatg
cacactaactaa

DBGET integrated database retrieval system