KEGG   Sarcophilus harrisii (Tasmanian devil): 100913927Help
Entry
100913927         CDS       T02286                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100913927 (EIF3B)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100913927 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 831 aa AA seqDB search
MQDAENVAVPEAAEQRPEPEQQAAEEEPERPAGPRVQEAAAAASVLVPEEKGGKVAAAVT
VAKSGLEPEALVKTPAEEKASGEPTSVESPPSSSSSPGEPQPEKILEPKAESLAAKEEKR
EEKEKAEDGGGKEEEEEKEEAGGEKKDQGKEGEAEPKRLENGNEEDEISFSDPEGFVDDI
SEEELLGDILKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDYYP
EEDGKTKGYIFLEYVSPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPE
KQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWS
PKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQA
IIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTMDTLSIYETPSMGLLDKKSLK
IPGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNG
DYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGE
APRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDC
TMMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLL
WRPRPPTLLSQDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKM
AQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggagaacgtggcggtgcccgaagcggccgagcagcggcccgagcctgag
cagcaggccgcggaggaggaaccggagcggcccgcggggcccagggtccaggaggcggca
gctgccgcctccgtgctcgtgcccgaagagaaggggggaaaggtcgcagctgcggtgacg
gtggctaagtccgggctggagcccgaggcactagtgaagactcccgcagaagagaaggcc
tccggagaaccgacctcggtcgaatccccgccttcgtcatcctcatctcctggggagccg
cagcccgagaagattctcgagcccaaggctgagtctctggcggctaaggaggaaaagcgg
gaggagaaagaaaaggcagaggacggaggaggaaaagaggaggaggaggagaaggaggag
gccgggggtgagaagaaagaccagggcaaagagggtgaggccgagcccaagcgcctggag
aatggcaacgaggaggacgagatctccttcagcgatcctgagggctttgtagatgacatt
agcgaggaagaattgctgggagatatactgaaagatagaccacaggaagctgatggaatt
gattccgtgatagtggtggataatgttcctcaggtaggaccagaccgtcttgagaaacta
aagaatgtcatccacaagatcttttccaagtttgggaaaataaccaatgattattaccca
gaggaagatggaaaaactaaaggttacatttttctggagtatgtctcacctgctcatgct
ttggacgcagttaaaaatgctgatgggtacaagcttgacaaacaacatacattcagagta
aacctttttacagactttgacaaatatatgacaattagtgatgaatgggacattccagag
aagcagccctttaaagacttgggaaatctacgctattggctggaggaagctgagtgcaga
gatcagtacagtgtcatctttgaatctggggatcgtacatctatattctggaatgatgtg
aaggatccagtatccattgaagaaagagcgagatggacagaaacctatgtgcgctggtct
ccaaagggcacttatttggctacattccatcaaagaggaattgctctctgggggggagaa
aaattcaaacaaattcagcgattcagccaccagggggtacagcttattgacttctcacct
tgtgaaaggtatcttgtgacttttagccctctgatggacacacaggatgaccctcaggcc
ataattatatgggacatcctcacgggacagaagaaacgaggatttcattgtgaaagctct
gctcactggcccatttttaagtggagtcatgatggcaagttttttgcccgaatgacaatg
gatacactcagcatttatgagactccgtctatgggtcttttggataagaaaagtttgaaa
atccctgggataaaggacttttcttggtcacctggtggtaacataattgctttttgggtg
ccagaagataaggacattcctgccagggtaaccttgatgcaactccccaccagacaagaa
atcagggttagaaatctgtttaatgttgttgactgcaaactacattggcaaaagaatgga
gattacttgtgtgtcaaagtagatagaactccaaaaggtacccagggtgtagtaaccaac
tttgaaatcttccgtatgagagagaaacaggtgcctgttgatgtagtggaaatgaaagaa
agcataatagcctttgcttgggaaccaaatggaagtaagtttgctgtgctacatggtgag
gctcctcgaatatctgtgtccttctaccatgtgaaaaataatggaaaaattgaacttatt
aaaatgtttgataagcagcaggcaaacacaatcttttggagtccccagggacaatttgtt
gttctagcaggtctgagaagcatgaatggtgccttggcatttgttgatacatcagattgt
accatgatgaacattgcagaacactacatggcttctgatgttgaatgggatcctacaggc
cgttatgttgtaacttcggtgtcctggtggagccacaaggtggataatgcgtactggtta
tggaccttccaaggacgtctccttcagaagaataacaaggatcgtttctgccagttgttg
tggaggcctcggcccccaaccttgctcagccaggatcagataaagcaaattaaaaaggat
ttgaagagatactccaagatttttgaacagaaggatcgtttgagccaatccaaagcctca
aaggaattagtagaaaggagacgtacaatgatggaagattttaggaaatatcgaaaaatg
gcccaagaactttatatggaacagaaaaatgagcgtctggaattacgaggaggtgtagac
actgatgaactagatagcaatgtagatgattgggaagaagagacaattgaattttttgtc
actgaagaaattattcctcttggaaaccaggagtaa

DBGET integrated database retrieval system