KEGG   Sarcophilus harrisii (Tasmanian devil): 100913960Help
Entry
100913960         CDS       T02286                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100913960
   03008 Ribosome biogenesis in eukaryotes
    100913960
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100913960
Ribosome biogenesis [BR:shr03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     100913960
Transfer RNA biogenesis [BR:shr03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100913960
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    100913960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 163 aa AA seqDB search
MDAACVGGAVPEFGWAHDIGAMAENGELWGAGEAELDPVEYTLRKRLPHRLPRRPNDIYV
NMKTDFKAQLARCQKLLEGGGGGRGQGGCPEIYIHGLGLAINRAINIALQLQAGSFGALQ
VAANTSTVELVDELEPENNNREPLTRTRNNSAIHIRVFRVTPK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagcgtgcgtaggaggggctgtgcctgagtttgggtgggcacatgacatagga
gctatggctgagaatggagagttatggggagccggtgaggcggaactggacccagtggag
tacactcttcgaaaacggcttccccatcgtcttccccgaagaccaaatgacatctatgtt
aatatgaagactgacttcaaggcccagctggctcgatgtcagaagcttctggagggtggt
ggagggggtaggggacagggtgggtgtcctgagatttacattcatggcctgggcctggcc
attaatcgagccatcaacattgccctgcaattgcaagctggaagctttggggccttgcaa
gtagctgccaacacttccactgtggaactggtagatgagctggagcctgagaataacaat
cgagagccattaacccgaacccgaaataactcagccatccacattcgagtcttccgtgtt
acacccaagtag

DBGET integrated database retrieval system