KEGG   Sarcophilus harrisii (Tasmanian devil): 100913960Help
Entry
100913960         CDS       T02286                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:shr03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:shr03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 163 aa AA seqDB search
MDAACVGGAVPEFGWAHDIGAMAENGELWGAGEAELDPVEYTLRKRLPHRLPRRPNDIYV
NMKTDFKAQLARCQKLLEGGGGGRGQGGCPEIYIHGLGLAINRAINIALQLQAGSFGALQ
VAANTSTVELVDELEPENNNREPLTRTRNNSAIHIRVFRVTPK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagcgtgcgtaggaggggctgtgcctgagtttgggtgggcacatgacatagga
gctatggctgagaatggagagttatggggagccggtgaggcggaactggacccagtggag
tacactcttcgaaaacggcttccccatcgtcttccccgaagaccaaatgacatctatgtt
aatatgaagactgacttcaaggcccagctggctcgatgtcagaagcttctggagggtggt
ggagggggtaggggacagggtgggtgtcctgagatttacattcatggcctgggcctggcc
attaatcgagccatcaacattgccctgcaattgcaagctggaagctttggggccttgcaa
gtagctgccaacacttccactgtggaactggtagatgagctggagcctgagaataacaat
cgagagccattaacccgaacccgaaataactcagccatccacattcgagtcttccgtgtt
acacccaagtag

DBGET integrated database retrieval system