KEGG   Sarcophilus harrisii (Tasmanian devil): 100914079Help
Entry
100914079         CDS       T02286                                 

Definition
uncharacterized LOC100914079
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100914079
   00240 Pyrimidine metabolism
    100914079
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100914079
   03410 Base excision repair
    100914079
   03420 Nucleotide excision repair
    100914079
   03430 Mismatch repair
    100914079
   03440 Homologous recombination
    100914079
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100914079
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100914079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 221 aa AA seqDB search
MGVISWDWWRPCHQPAAVGGSEAAGRAGLAPHDQGFEALGVPSGHVPPMPGPLARPPESG
RGTCEGKGSQELGGRSQLSGRPAGPRLLPARPGGVRPAQPRPPCPPGPPPPSPRVSLRSP
ESRRIVGGKEPGAGLEAQPLLSGEESGEEPLAPLEDKTHLELLRQFDLDRHFGPCTGITR
LQRWERAEQLGLGPPHEVLKVLWAHPGDPQYQCSLWHLYPI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaatcagctgggattggtggcgtccctgtcaccagccagcggccgtgggaggc
tcagaggctgcgggtcgggcgggtctggcccctcacgaccaaggcttcgaggcgctgggg
gtcccctctggacacgtgcccccgatgccagggccgctggcccgacccccagaatcaggc
agagggacttgtgaggggaagggcagccaagagctgggggggaggagccagctctcgggg
cggcctgcgggtccccgactactcccggcccggcccggcggggtccgccccgctcagccc
aggcccccgtgcccgccaggcccccctcccccctccccccgcgtctcccttcgatccccg
gagtcccggcggattgttggggggaaggagccaggggccgggcttgaagcgcagcctctc
ttgtcaggggaggagtcgggggaggagccgctcgcacccctggaggacaaaactcattta
gagctactgaggcagtttgacctggacaggcacttcggcccctgcacagggatcactcgg
cttcagcgctgggagcgggcagagcagctgggcctgggccctccccatgaggtgctcaag
gtgctgtgggcccaccctggagacccccagtaccagtgcagcctctggcacctgtacccc
atctaa

DBGET integrated database retrieval system