KEGG   Sarcophilus harrisii (Tasmanian devil): 100914156Help
Entry
100914156         CDS       T02286                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100914156 (DHCR7)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100914156 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 462 aa AA seqDB search
MAPSSPTSSPKQRDPKKFPDGNGTAQGAWGRAWEVDWFSLASVVFLLLFAPLIVYYFIMS
CDQYSCSLTAPVLEVVTGRSSLSEIWARTPGVTARAAQIYVVWVAFQVVLYMMVPDFCHK
FLPFYVGGVQEGAVTPAGTVNKYEINGLQAWIITHLLWFANAQFFHWFSPTIIFDNWIPL
LWCANILGYAVSTFAIVKGYFFPTNARDCKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQQELHGSVTNAMVLVNVLQALYVVDFFWNEAWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSALHALGVLLLGLGGYYIFRAANHQKDL
FRKTNGHCTVWGRKPRYIECSYTSSDGRRHRSRLMVSGFWGLARHLNYTGDLMGSLAYCL
ACGFSHLLPYFYIIYMPPAPSEDGSSSGGSASMAESRTTSWV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgagttccccaaccagctctcccaagcagagggaccccaagaagtttccagat
ggcaacggcacagctcaaggggcttggggccgagcctgggaggtggactggttctccttg
gcgagcgtcgtcttcctgctgctgttcgcccccctcatcgtttactacttcatcatgtcc
tgcgaccagtacagctgctcgctcacggcgcccgtgctggaggtcgtgacgggcaggtcc
agcctctcggagatctgggcccggacgccgggggtgacggccagagcggcacagatctac
gtcgtctgggtcgcttttcaggtggttttatacatgatggttcctgatttttgccacaaa
tttttgcccttctacgtgggaggcgttcaagaaggggccgtcacccctgcaggaaccgtg
aacaagtatgagatcaatggccttcaggcctggatcatcacccacctgctgtggtttgca
aatgctcagtttttccactggttctcacccacgatcatcttcgacaactggatcccgctc
ctgtggtgcgccaacattctgggctacgccgtgtccaccttcgccatcgtcaaagggtac
ttcttccccaccaatgcccgagactgcaagttcacaggcaacttcttctacaactacatg
atgggtgtggagttcaacccgaggatagggaagtggttcgacttcaagctcttcttcaat
ggccgccccgggatcgtcgcctggacgctcatcaatctgtccttcgccgccaagcagcaa
gagctgcacggctcggtgaccaacgccatggtcctggtcaacgtcctgcaggctctctac
gtggtggactttttctggaatgaagcctggtacctgaaaaccatcgacatctgccacgac
cacttcggctggtacctgggctggggggactgcgtctggctgccttacctctacaccctg
cagggcctgtacctggtctatcaccccgtgcagctctcggcactgcacgcgctgggcgtc
ctactgctgggcctgggcggctactacatcttccgggcggccaaccaccagaaggacctc
ttccgcaagaccaacggccactgcacggtgtggggccgcaagccgcgctacatcgagtgc
tcgtacacctcgtccgacgggcgccggcaccgcagccgcctcatggtctcgggcttctgg
gggctggcgcgacacctcaactacacgggcgacctcatgggcagcctggcctactgcctg
gcctgtggcttctcgcacctgctgccctacttctacatcatctacatgccacctgctccg
tcagaagacggctcttcctcggggggctcggcctccatggctgaatctcgcacaacgtcc
tgggtctga

DBGET integrated database retrieval system