KEGG   Sarcophilus harrisii (Tasmanian devil): 100914482Help
Entry
100914482         CDS       T02286                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 202 aa AA seqDB search
MSCMPWRGDKTKSESLELPQPAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKVPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcatgccatggagaggtgacaagaccaaatcagaatcattggaactgccccag
ccggcgcccccccagatctaccatgagaagcagcggcgggagctgtgcgccctccacgcg
ctgaacaacgtcttccaagacagcaatgctttcacccgggaaacactacaggagattttc
cagaggctgtctccaaacaccatggtgacgccccacaagaagagcatgctgggtaatggg
aactacgatgtgaatgtcatcatggcagcccttcagaccaaaggctacgaagcggtttgg
tgggacaagcgaagggacgtcagtgtcattgccctctccaacgtcatgggcttcatcatg
aatctcccctccagtctctgctggggtcctctgaagctccccctcaagaggcagcattgg
atctgtgtccgagaggtgggaggtacctactacaaccttgactccaagctcaaggtgccc
gagtggatcggaggcgagagcgagctcaggaaatttttaaaacatcagctccgaggaaag
aactgtgagctgctgcttgtggtcccagaagaggtggaggcccaccagagttggagggcg
gatgtgtaa

DBGET integrated database retrieval system