KEGG   Sarcophilus harrisii (Tasmanian devil): 100914496Help
Entry
100914496         CDS       T02286                                 

Definition
uncharacterized LOC100914496
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100914496
   00053 Ascorbate and aldarate metabolism
    100914496
   00500 Starch and sucrose metabolism
    100914496
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100914496
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100914496
   00860 Porphyrin and chlorophyll metabolism
    100914496
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100914496
   00982 Drug metabolism - cytochrome P450
    100914496
   00983 Drug metabolism - other enzymes
    100914496
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100914496
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100914496
Glycosyltransferases [BR:shr01003]
 Others
  Hydrophobic molecule
   100914496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 543 aa AA seqDB search
MTLLGTVFGGNVLIWPMEGSHWLNIKIILGKLIEKQHNVTVLVASGALFITPTTDSSLKF
EVYKVSFEKEKIEGVIRSFVLTWLENKPSPATIWRFYSKMTPVIHEFHQVSRAICDGVLT
KQKLMDKLQKGKFDILISDPVFPCGDLIALKLGIPFIYSLRFSPASTVEKHCGKVPYPPS
YVPAVLSELTDQMSFSDRIRNFISYHLQDYMFNTLWSPWDSYYSKILDASHWLNIKIIIE
ELIQRNHNVTVLTSPSALFIKSSPDLQVNFEVFPVPFGKKDIDSLIHDLIMLWLDHRPTP
LTLWKFYRELGKFFETIFKINMQICDGVLNNRGLMAKLQMARFDVLLADPVTICGDLVAL
KLGIPFMYTLRFTPASTVERHCGKIPAPVSYVPAALSELTDQMPFGERIKNMLSYPLQDY
IFQSYWGEWDLYYSKILGIYFILIVMETKVKLTRTEQGDFSVFLLQLSYFAPVKCGKMLI
RSVNFSHWLHSDIIVEELKLQDHEITVLMPSLNILLASTQFPFKVEVLTLPVIKIKLIGE
LHA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgactctactagggacagtttttggtggaaatgttctgatttggccaatggaaggtagt
cactggcttaatatcaagataattttagggaaactgatagaaaaacagcacaatgtcaca
gtactggttgcttctggagcactcttcatcacacctactactgattcatctttgaaattt
gaagtatataaagtatcctttgaaaaggaaaaaatagagggtgtcatcaggagttttgtt
ctcacatggctggaaaataagccctctcctgcaactatctggcgtttctactcaaaaatg
accccagtcattcatgagttccaccaagtgtctagagcaatctgtgatggtgtgcttacc
aagcagaagttaatggataagctgcagaagggcaaatttgatattttaatctcagatcca
gtatttccctgtggtgacctgattgcccttaagttgggaatcccatttatatattccttg
agattctctccagcctccacagtggaaaaacactgtgggaaagtgccatatcctccttcc
tatgttcctgctgtcttgtcagagctcaccgaccagatgtcttttagtgacagaataaga
aacttcatctcctaccatttacaggactacatgtttaatactctttggtccccgtgggat
tcctactatagcaaaattttggatgccagccactggctaaatattaagatcattatagag
gaactgattcaaagaaatcataatgtcactgtgctgacatcaccaagtgctctcttcatt
aaatctagtcctgatttacaggtgaactttgaggtgtttcctgttccttttgggaagaag
gatatagattccttgattcatgatttgattatgctgtggttagaccacagaccaactcct
ttgacgctctggaagttctatcgggaactgggaaaattctttgagaccatctttaaaatt
aatatgcaaatctgtgatggagtgctaaacaaccgagggttaatggcaaagcttcaaatg
gcaaggtttgatgtattattagcagacccagtaaccatctgtggggacctagttgctctc
aagttaggaattccatttatgtacaccttgagattcacacctgcctcaacagtggagaga
cactgtgggaaaatcccagcccctgtctcctatgtaccagcggccttgtcagaactcaca
gatcagatgccctttggagaacgaattaaaaacatgttatcatatcctctgcaagactat
atatttcagtcctactggggagaatgggatttatactacagcaaaatattgggcatttat
ttcattctaattgtaatggaaacaaaagtgaaactcactagaaccgagcagggggatttt
agtgttttcctgctccagctgtcttactttgctcctgtaaaatgtggcaaaatgctcatc
aggtctgtgaattttagtcactggctccatagcgatatcattgtggaagaactcaaacta
caggaccatgaaatcactgtcttgatgccttcactaaatattcttcttgcttctacccaa
tttccttttaaggttgaagtgctcaccttgccagttattaagataaaactgattggtgaa
ctacatgcctag

DBGET integrated database retrieval system