KEGG   Sarcophilus harrisii (Tasmanian devil): 100914496Help
Entry
100914496         CDS       T02286                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC100914496
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00040  Pentose and glucuronate interconversions
shr00053  Ascorbate and aldarate metabolism
shr00140  Steroid hormone biosynthesis
shr00830  Retinol metabolism
shr00860  Porphyrin and chlorophyll metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01100  Metabolic pathways
shr05204  Chemical carcinogenesis
Module
shr_M00014  Glucuronate pathway (uronate pathway)
shr_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100914496
   00053 Ascorbate and aldarate metabolism
    100914496
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100914496
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100914496
   00860 Porphyrin and chlorophyll metabolism
    100914496
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100914496
   00982 Drug metabolism - cytochrome P450
    100914496
   00983 Drug metabolism - other enzymes
    100914496
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100914496
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100914496
Glycosyltransferases [BR:shr01003]
 Others
  Hydrophobic molecule
   100914496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100914496
NCBI-ProteinID: XP_023361744
Position
6
AA seq 514 aa AA seqDB search
MSITISIFQMKEPGILQVKRFCHTNVATKEKHLFALDPSKTSXSTCTMLGKTTLFLAFHM
TLLGTVFGGNVLIWPMEGSHWLNIKIILGKLIEKQHNVTVLVASGALFITPTTDSSLKFE
VYKVSFEKEKIEGVIRSFVLTWLENKPSPATIWRFYSKMTPVIHEFHQVSRAICDGVLTK
QKLMDKLQKGKFDILISDPVFPCGDLIALKLGIPFIYSLRFSPASTVEKHCGKVPYPPSY
VPAVLSELTDQMSFSDRIRNFISYHLQDYMFNTLWSPWDSYYSKILDASHWLNIKIIIEE
LIQRNHNVTVLTSPSALFIKSSPDLQVNFEVFPVPFGKKDIDSLIHDLIMLWLDHRPTPL
TLWKFYRELGKFFETIFKINMQICDGVLNNRGLMAKLQMARFDVLLADPVTICGDLVALK
LGIPFMYTLRFTPASTVERHCGKIPAPVSYVPAALSELTDQMPFGERIKNMLSYPLQDYI
FQSYWGEWDLYYSKILAVIANSYSTLSQSTGIIV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaccatctccattttccagatgaaggaaccaggaatcctacaggtgaagcga
ttttgccacacaaatgtggccacaaaggaaaaacatctgtttgctttggaccccagtaag
acttccnnatcaacgtgcaccatgttggggaagactaccctgtttctggcttttcacatg
actctactagggacagtttttggtggaaatgttctgatttggccaatggaaggtagtcac
tggcttaatatcaagataattttagggaaactgatagaaaaacagcacaatgtcacagta
ctggttgcttctggagcactcttcatcacacctactactgattcatctttgaaatttgaa
gtatataaagtatcctttgaaaaggaaaaaatagagggtgtcatcaggagttttgttctc
acatggctggaaaataagccctctcctgcaactatctggcgtttctactcaaaaatgacc
ccagtcattcatgagttccaccaagtgtctagagcaatctgtgatggtgtgcttaccaag
cagaagttaatggataagctgcagaagggcaaatttgatattttaatctcagatccagta
tttccctgtggtgacctgattgcccttaagttgggaatcccatttatatattccttgaga
ttctctccagcctccacagtggaaaaacactgtgggaaagtgccatatcctccttcctat
gttcctgctgtcttgtcagagctcaccgaccagatgtcttttagtgacagaataagaaac
ttcatctcctaccatttacaggactacatgtttaatactctttggtccccgtgggattcc
tactatagcaaaattttggatgccagccactggctaaatattaagatcattatagaggaa
ctgattcaaagaaatcataatgtcactgtgctgacatcaccaagtgctctcttcattaaa
tctagtcctgatttacaggtgaactttgaggtgtttcctgttccttttgggaagaaggat
atagattccttgattcatgatttgattatgctgtggttagaccacagaccaactcctttg
acgctctggaagttctatcgggaactgggaaaattctttgagaccatctttaaaattaat
atgcaaatctgtgatggagtgctaaacaaccgagggttaatggcaaagcttcaaatggca
aggtttgatgtattattagcagacccagtaaccatctgtggggacctagttgctctcaag
ttaggaattccatttatgtacaccttgagattcacacctgcctcaacagtggagagacac
tgtgggaaaatcccagcccctgtctcctatgtaccagcggccttgtcagaactcacagat
cagatgccctttggagaacgaattaaaaacatgttatcatatcctctgcaagactatata
tttcagtcctactggggagaatgggatttatactacagcaaaatattggccgtcattgct
aactcatattctaccctttcccagtctactggcatcatagtttga

DBGET integrated database retrieval system