KEGG   Sarcophilus harrisii (Tasmanian devil): 100914498Help
Entry
100914498         CDS       T02286                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100914498 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 856 aa AA seqDB search
MSLQILNDENITGDITAETCDFLFTPPELTGTLSFFRTSQKENVPPKSIAKSMKVTFQTP
LRDPQTNRILSPTMTTKLENSFTLDDCTDDLKDAHPPASRNEKNQQVTKGVDRKTMNETS
QRQETNPALYPDLLPVKSSGSYHIDLDSLMDFDPFVNSSQNPRSPLVTNDSELVLEEINC
YSLDETYPFISEDFKESSGIKSSRSPEKISEKSCGSLKSASLTDKNTDEINRVAVLEEKS
DGSVVTQNLMNGVVSNKEEQNLSLDSGQPEEPVSNTAHDIQPASISTHLVACNSDFVNND
EKKTIDSELSALPLVEEKPVHVVEPLKSQPVKLEFDFSDNITVKPPPRKLGKGPGIKSLS
KKPSVTQERVTKNLAKESKCQDKENMDPLPKGSYNLDWDKLDDPNFNPFGKRSKPSPSSH
HQQSSNEITELQENLAAQSDSLPSEQNSMTAIDDIPKSQQVLTPVAAAESMLPVGTETLI
TGDQEKTENSNTSSSQVVSPALTTGSELHQKEELDTNVKGETAISEEDFRSPSQVLGTGI
EIDYLEQFGTSSFKESALRKQSLYLKFDPLLKESPNKLAPVNIEITNGLLDSGKKSQKNQ
DDAKLDEFDFLGTFNIPVIGLPDGPDCMSVPVTTTDLPVSVDAIIDVLKYSQKDMDVAVE
KVKEEVKEKQMKIQELEDKYTKFHVEYLDMGKIVEEYEGIITQLMADAQKQKEVSKAEIQ
KILSEKQQITADLNSMEKSFSDLFKRLEKQKEVLEGYQKNEEALKKCVEDYLLRIEKEER
RYKALKAHAEEKLNLANEEIAQVRSKAKAETLALQANLRKEQMRVQSLEKSLEQKTKEND
ELTKICDDLISKMEKI
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatcttaaatgacgaaaatattactggtgatataactgcagaaacttgt
gacttcctgtttacaccgccagagctaacaggaacattatcattttttcgtacgtcccag
aaagaaaatgtgccaccaaaaagtatagcaaaatctatgaaagtaacttttcaaactcct
ttgcgggatccacagacaaatagaattttaagcccaaccatgacaactaagcttgagaat
tcttttaccctggatgattgtacagatgatttaaaggatgctcatcctcctgcatcaaga
aatgaaaaaaatcagcaggtaaccaaaggagttgataggaaaacaatgaatgaaacttct
caaagacaagaaacaaatcctgccctttatccagatctgctgccagtgaaaagcagtggc
tcctaccatattgacttggatagtctgatggattttgacccgttcgtaaactcatcccag
aatccaagatctccattagtaaccaatgactctgaacttgtcttagaagaaattaactgt
tactcattggatgaaacttatccatttatttctgaagactttaaagaatcctcaggaata
aaatcttcgagaagccctgaaaaaatttcagagaaaagttgtggtagtctaaaatctgct
tcattgactgacaaaaacactgatgaaataaatagagtagccgtcttagaagaaaagtct
gatggcagtgtggtaacccagaatcttatgaatggagttgtgtccaataaggaagaacag
aacttatctttggactcgggacagcctgaagaaccagtttctaatacagctcatgatatc
cagcctgccagtatatcaacacatttggtagcttgtaactctgactttgtcaacaatgat
gaaaaaaagacaatcgattctgagttatcagctcttccccttgtagaagagaagcctgta
cacgtggttgagcctttgaaatcccagcctgtaaaactagaatttgatttttctgataac
attactgtcaagccaccaccaagaaaattaggaaagggtcctggaattaaatctctttct
aagaaaccttctgtaacccaggagagagtgacaaaaaacctggcaaaggaaagcaaatgt
caggataaagaaaatatggaccctcttccaaagggatcttataatttagactgggacaag
cttgatgatccaaattttaacccatttgggaaaaggtctaagccttctccttcttctcat
catcagcaatctagtaatgaaatcactgaacttcaagagaatcttgcagcacagagtgac
agccttcctagtgagcagaatagtatgactgctattgatgacatacccaaaagtcagcag
gttcttactcctgttgctgctgctgaatctatgcttccagtaggaacagaaactttgata
actggggatcaggagaaaacggaaaattcaaatacttcaagcagtcaagttgttagtcca
gcattaaccactggttctgaactccaccagaaggaggaattggacacaaatgtcaaggga
gaaactgctatatctgaagaggacttcagatctccttcacaagttttaggcacgggtata
gaaatcgactatttggaacaatttggaacttcttcattcaaggaatctgctttgaggaaa
cagtccttatatcttaaatttgacccactactgaaagagagtcctaataaactagctcct
gtaaatattgaaataacaaatggccttctggactctggaaaaaaatctcagaaaaatcaa
gatgatgcaaaacttgatgaatttgacttcctaggaacatttaatattcctgtaatagga
cttcctgatggacctgattgtatgagtgttcctgtgacaaccacagatttgcctgtttct
gttgatgctattatagatgtgttgaagtacagtcagaaagacatggatgtggctgtagaa
aaagtcaaagaagaagttaaagaaaaacaaatgaaaattcaagaattggaagacaaatat
acaaaattccatgtggaatatttagatatggggaaaattgtagaagaatatgaagggata
ataactcaattgatggcggatgctcagaagcagaaagaggtttcaaaggctgaaatccag
aagattttgtcagaaaaacagcaaattacagcagacctgaattccatggaaaaatctttt
tctgatctcttcaaacgactagaaaaacagaaggaagttttagaaggatatcaaaagaat
gaagaagccttgaagaaatgtgttgaagattatctgctgagaattgaaaaggaagagaga
aggtataaagcgctcaaggctcatgcggaagagaaattaaacctagcgaatgaagagatt
gcccaggttcggagcaaagctaaagctgagactcttgctttacaagcaaatttacgaaag
gaacaaatgcgagttcagtcactagagaaaagcctggaacaaaaaactaaagaaaatgat
gaattaaccaaaatctgtgatgacctgatttcaaagatggagaagatctaa

DBGET integrated database retrieval system