KEGG   Sarcophilus harrisii (Tasmanian devil): 100914658Help
Entry
100914658         CDS       T02286                                 

Definition
glutathione S-transferase kappa 1-like
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:shr00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:shr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:shr00982]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:shr04146]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:shr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 227 aa AA seqDB search
MASLPRKLELFYDVLSPYSWLGFEVLCRYQNIWNINLQLRPSFIAGIMKSSGNKPPALVP
RKGKYMMTDLQHLKNFYQVPIQAPKDFFSVILEKGSLTAMRFLTAVNMEKPEMLEKVSRE
LWMRVWSRDEDITEPQSILTAAKKAGLSEAEAKGLLEKCSSDNVKSRLKETTDAACNYGA
FGLPTIVVHMDDNKSHMLFGSDRMELLAHLLGEQWLGPVPSTVKGKL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcttgcctaggaagttggagctcttctacgatgtgctgtccccgtattcctgg
ctgggctttgaggtcctttgtcgatatcagaacatctggaatatcaaccttcaactgcgc
cccagcttcatcgcaggaatcatgaagagcagtggaaacaaaccacctgccttggtgcca
agaaaaggcaaatacatgatgacagacctccaacatcttaagaacttttaccaggttccc
atccaggctccaaaggatttcttctctgtcatactagaaaaagggagtttgactgctatg
cgattcctcactgctgtcaacatggagaaacctgagatgttagaaaaagtgtctcgagag
ttgtggatgcgtgtttggtcacgagatgaagatatcaccgaaccccaaagcatcctgact
gctgcaaagaaagcaggactttctgaagcagaggctaagggtctactggaaaagtgttca
agtgacaacgtgaagagcagactcaaagagaccactgatgcagcctgcaattatggggcc
tttgggctgcccaccatagtggtccacatggatgataacaaatcccacatgctttttggt
tctgacaggatggagctgctggcccacttactaggagaacagtggctaggcccggtgccc
agcactgtgaagggtaagctctga

DBGET integrated database retrieval system