KEGG   Sarcophilus harrisii (Tasmanian devil): 100914792Help
Entry
100914792         CDS       T02286                                 

Gene name
KAT8
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100914792 (KAT8)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100914792 (KAT8)
   HAT complexes
    NSL complex
     100914792 (KAT8)
    MSL complex
     100914792 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 455 aa AA seqDB search
MATASSATAATVGAPGEGEAGGGERAIAXXXXXPPGRASPPAPARGEPEVTVEIGETYLC
RRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKEAVQKNS
EKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIH
IGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRK
NNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFS
KEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRS
YWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVE
EHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcaagctccgctacggcggccacggtcggagccccgggggagggcgaggcc
gggggcggggagagagctatcgcnnnnnnnnnnnnnnngcccccaggccgcgcctcccct
ccggccccggcccgcggcgagcccgaggtcacggtggagatcggagaaacctacctttgc
cgacgtccggatagcacttggcactcagcagaggtgattcagtcccgtgtgaatgaccaa
gaaggacgagaggaattctatgtgcattatgtgggctttaatcgtcgtctggatgaatgg
gttgacaagaaccgactggccttgaccaagacagtgaaagaagctgttcaaaagaactct
gagaagtacctaagtgagctggcagagcagcctgagcgcaagatcacccgcaaccagaaa
cgcaagcatgatgaaatcaaccatgtgcaaaagacctatgcagaaatggatcccacaaca
gcagcactagaaaaggaacatgaagcaattactaaagtgaagtatgtggataagattcat
attggaaactatgagattgatgcctggtacttctccccattcccagaagattatgggaaa
cagcccaaactttggctttgtgaatactgcctgaagtacatgaagtttgagaagagctac
cgtttccatttggggcagtgtcaatggagacagccacctggcaaggaaatttatcgaaag
aacaacatctccgtgtatgaagtggatggcaaagaccacaagatttattgccagaacctg
tgtctattggccaagcttttcctggaccacaagaccctgtactttgatgtggaaccattt
gtcttctacatcttgactgaagtggacagacagggagcccacattgtgggctacttctct
aaggagaaggagtccccagatgggaataatgtggcctgtatcctgaccctccccccatat
cagcggcgaggttatggcaagttcctcattgccttcagttacgaactgtcgaagttagag
agtacagtgggttctccagagaagccactgtcagacctggggaagctgagctatcgtagt
tattggtcctgggtcttgctggagatcctgagggacttccgaggcacactgtcaatcaaa
gatctcagccagatgaccagcatcactcaaaatgacatcatcagcactctgcagtcactc
aatatggtcaagtactggaaagggcagcatgtcatctgtgtcacccccaagctagtagaa
gagcatctcaagagcgcccagtacaagaagccccccataacagtggactcagtttgtctc
aagtgggcaccacccaagcataagcaagtaaagttgtctaagaagtga

DBGET integrated database retrieval system