KEGG   Sarcophilus harrisii (Tasmanian devil): 100914792Help
Entry
100914792         CDS       T02286                                 

Gene name
KAT8
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100914792 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 503 aa AA seqDB search
MSYGRKGGGKEKRGRPGRAPSWSVPTHSDSIVVHNVTRFRLPFASKGPILPYGTRKLGGI
ESPDSYVTSDRFDGDGKLRYGGHGRASPPAPARGEPEVTVEIGETYLCRRPDSTWHSAEV
IQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKEAVQKNSEKYLSELAEQPE
RKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFS
PFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKNNISVYEVDGKD
HKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVA
CILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRD
FRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPP
ITVDSVCLKWAPPKHKQVKLSKK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacggaagaaaggggggcgggaaagagaaacgaggccgcccgggccgcgccccc
tcatggtcggtccctacccatagcgactcaatcgtggtacataacgtcacgcggttccgc
ctcccctttgcttctaaaggccccattctgccgtacgggacccggaagttagggggcatc
gagtcgcctgattcttacgtcacttccgaccggttcgatggcgacggcaagctccgctac
ggcggccacggccgcgcctcccctccggccccggcccgcggcgagcccgaggtcacggtg
gagatcggagaaacctacctttgccgacgtccggatagcacttggcactcagcagaggtg
attcagtcccgtgtgaatgaccaagaaggacgagaggaattctatgtgcattatgtgggc
tttaatcgtcgtctggatgaatgggttgacaagaaccgactggccttgaccaagacagtg
aaagaagctgttcaaaagaactctgagaagtacctaagtgagctggcagagcagcctgag
cgcaagatcacccgcaaccagaaacgcaagcatgatgaaatcaaccatgtgcaaaagacc
tatgcagaaatggatcccacaacagcagcactagaaaaggaacatgaagcaattactaaa
gtgaagtatgtggataagattcatattggaaactatgagattgatgcctggtacttctcc
ccattcccagaagattatgggaaacagcccaaactttggctttgtgaatactgcctgaag
tacatgaagtttgagaagagctaccgtttccatttggggcagtgtcaatggagacagcca
cctggcaaggaaatttatcgaaagaacaacatctccgtgtatgaagtggatggcaaagac
cacaagatttattgccagaacctgtgtctattggccaagcttttcctggaccacaagacc
ctgtactttgatgtggaaccatttgtcttctacatcttgactgaagtggacagacaggga
gcccacattgtgggctacttctctaaggagaaggagtccccagatgggaataatgtggcc
tgtatcctgaccctccccccatatcagcggcgaggttatggcaagttcctcattgccttc
agttacgaactgtcgaagttagagagtacagtgggttctccagagaagccactgtcagac
ctggggaagctgagctatcgtagttattggtcctgggtcttgctggagatcctgagggac
ttccgaggcacactgtcaatcaaagatctcagccagatgaccagcatcactcaaaatgac
atcatcagcactctgcagtcactcaatatggtcaagtactggaaagggcagcatgtcatc
tgtgtcacccccaagctagtagaagagcatctcaagagcgcccagtacaagaagcccccc
ataacagtggactcagtttgtctcaagtgggcaccacccaagcataagcaagtaaagttg
tctaagaagtga

DBGET integrated database retrieval system