KEGG   Sarcophilus harrisii (Tasmanian devil): 100914804Help
Entry
100914804         CDS       T02286                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:shr04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:shr04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:shr04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:shr04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:shr04660]
Organismal Systems; Development; Axon guidance [PATH:shr04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:shr05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEERKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKSSETSAAVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPIPAPAGDSNVDSAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagccaccagcgcctcctgtccgtatgagcagt
actatttttagcactggaggcaaagaccctttgtcagctaaccatagtttgaaacctttg
ccatctgttccagaggaaagaaagcctaggaataagatcatctccatattttcaggcaca
gagaaaggaagtaagaaaaaagaaaaggaacggccagaaatttctcctccttctgatttt
gaacacaccatccatgttggctttgatgctgttactggagaattcactggaatgccagaa
cagtgggctcgattgctacagacttccaatatcaccaaactagagcaaaagaagaacccc
caggctgtgctggatgttctaaagttctatgactccaatacagtgaaacagaaatatttg
agctttacccctcctgagaaagatggctttccctcaggaacaccagcactaaatgcaaaa
agctcagaaacttcagcggcagtaacagaagaagatgatgatgatgaggagactgcacca
cctgtcattgctcctagaccagatcatacaaaatcaatttacacacggtctgtaattgac
cctattcctgcaccagctggtgattctaatgttgatagtgctgccaaatctttagacaaa
cagaaaaagaagactaaaatgacagatgaagaaattatggagaaactaagaactatagtc
agcataggtgatcccaagaaaaaatatacccgatatgaaaaaattgggcaaggagcttca
ggtacagtttttactgctacagatgtggcattggggcaggaggttgccatcaaacagata
aatttgcagaaacagcctaagaaggaattaatcattaatgaaattcttgtaatgaaagaa
ttaaaaaatcccaatatagtcaacttcttagatagttatcttgtaggggatgaattattt
gtggtaatggagtaccttgctggagggtctcttactgatgttgtaacagaaacctgcatg
gatgaagcacagattgctgctgtgtgtagagagtgtttacaagctctggagtttctacat
gccaatcaggtgattcacagagacatcaaaagtgacaatgtgcttttgggaatggaagga
tcagttaaactcaccgactttggtttctgtgcccagatcacaccagagcagagcaaaaga
agtactatggtggggaccccttactggatggcaccggaagtggtcacacgtaaagcttat
ggtcctaaagtggacatttggtctttaggaattatggctattgaaatggtggaaggagaa
cccccataccttaatgagaatcctctgagggccttgtatctaatagcaacaaatgggact
cctgaactgcaaaatccagagaaactatctccaatatttcgagatttcttaaatcgatgt
ttggagatggatgtagaaaaaaggggctcagccaaagaattgttacagcatcccttcctg
aaactggctaaacctttgtctagcttgacaccgctgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system