KEGG   Sarcophilus harrisii (Tasmanian devil): 100914807Help
Entry
100914807         CDS       T02286                                 

Gene name
MMP8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100914807 (MMP8)
Peptidases [BR:shr01002]
 Metallo Peptidases
  Family M10
   100914807 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 502 aa AA seqDB search
MSPREASKEDPHPKSLTFLVEKEVLLKEMEIIPNMKKVLLFLLLFHTQLSRAFPVSPKSL
KEKKMEIAQRYLEKFYDMPKIGDKVKRQRNNTQLVEKLKEMQKFFGLEETGQPDEETMKV
MEMPRCGVPDVYGYKLTEGNPKWKKTEITYSIINYTPDIPEADVDSAIEKAINIWSDPTP
LKFSRKNNNEADIKISFVRGDHGDNSPFDGEGGILAHAFQPGQGIGGDVHFDEDETWSTN
SRGYNLFLVAAHEFGHSLGLSHSADPGALMFPTYSFSEPSTYVLPQDDIDGIQFIYGNSN
NPIKPTGPTTPRTCDPQLTFDAITTLRGEVIIFKDKYFWRKHRHIIRPELHMISLFWPSL
PSGIQAAFEDVANDLVFLFKDKQYWILEGYDIRPGYPRDISDFGFPRTVQAIDAAVSNYY
NRKTYFFVKHQYWRYDNSRFAMDPGYPKNIADNFQGLENRVDAVFQKNQYFYFFSGPTYY
KFDLYTNRIIALGRSNRLLNCR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaagggaagcaagcaaagaagatcctcacccaaagagcctgactttcctagtg
gagaaagaggtactgctgaaagaaatggaaatcatcccaaatatgaagaaggtccttctg
tttcttctcttatttcacacacagctttcaagagcttttcctgtttctcctaaaagcctt
aaagagaaaaaaatggaaattgctcagaggtatctggaaaaattttatgatatgccaaaa
attggagataaggtaaaacggcagagaaataacactcaattggttgaaaagcttaaagaa
atgcagaaattctttggattggaggagactggacaaccagatgaggaaactatgaaagta
atggaaatgcccagatgtggggttcctgatgtatatggatataagctgactgaaggaaat
ccaaaatggaaaaagactgaaattacatatagcattataaactacacaccagatatacca
gaagctgatgtggattcagcaattgagaaagccataaatatctggagtgatccgacacct
ctgaagttctccagaaaaaataataatgaagctgacataaagatctcttttgtccgagga
gatcatggcgacaattcaccttttgatggtgagggtggaatccttgcacatgcttttcaa
ccaggccagggaattggaggagatgttcattttgatgaagatgaaacttggtccacaaac
tccaggggttataacttattccttgttgctgctcatgaatttggccattcattagggctt
tctcattccgctgatcctggtgccttgatgttccccacttattccttctctgaacccagc
acttatgtactgcctcaagatgatattgacggcatccagtttatctatggtaattcaaat
aatcccatcaaacctactggacccaccacaccaagaacctgtgacccacagttgacgttt
gatgcaatcaccactctccgtggagaagtcataatctttaaagacaagtacttttggcga
aagcaccgccacataataagacccgaactccatatgatttccttattctggccatcatta
ccatctgggatacaagctgcttttgaagatgttgcaaatgacttagtttttctatttaaa
gataaacaatactggattctggaaggctatgatatcaggcctggctatcccagagatatt
tctgactttggcttcccaagaactgtgcaagccattgatgcagctgtttcaaattattac
aacagaaaaacatacttctttgtaaagcatcaatactggagatatgataatagcagattt
gctatggatcctggctatcctaaaaatatagcagataattttcaagggttggaaaacaga
gtggatgctgttttccagaaaaatcagtatttctacttctttagtggaccaacatactac
aaatttgatctctatactaatagaatcattgctcttggaagaagcaaccgcttattaaat
tgtagatag

DBGET integrated database retrieval system