KEGG   Sarcophilus harrisii (Tasmanian devil): 100914879Help
Entry
100914879         CDS       T02286                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100914879 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 335 aa AA seqDB search
MKMEHNMSRIHMVSEPSIIYFLQVSWEKDLGSGFDITLTDGQSAWNGTVTASEISREADD
MAMERDKYVDELRKALVLRTEPANVYKFDFSKENCHFSYEKSLKDVSFILGSLNLQKVSS
PAEVIRELMSYCLDCMADQLAKNRHLQRENEMLQRDWSDVQKRLEECVTAKENLEADLYK
RFVLVLNEKKGKIRSLHKLLKQAQQPEKDTQDERESVDDIQSQKKREAAYDESTDEESEN
LPVPSKAVPANFSQNDSIISSPDVTDIAPSRKKRQRLQKKVDTEAQFVPQKPTLQEKEKP
ESSQLQSSSKEPFSSENMSLETLKNSSPEDLFDDM
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggagcacaatatgagcagaatccatatggtttctgaacccagtataatttat
tttctacaagtatcttgggaaaaagatctaggttctggttttgacataactcttacagat
ggtcagtcagcatggaatggaacagtgactgcatctgagatttccagggaagctgatgac
atggcaatggaaagagacaagtatgttgatgaactgagaaaagcattggtgctgagaaca
gaaccagctaatgtgtacaaatttgatttttctaaagagaattgccatttctcctatgaa
aaaagcctgaaagatgtttcttttatacttggatcactgaacctgcagaaggtctcaagc
ccagctgaagtcatccgagaactgatgagctattgcctagactgtatggctgaccagctc
gccaagaacagacacctgcagagagagaatgagatgcttcagagggactggagcgatgtc
caaaaacgtcttgaagagtgtgtgactgctaaagaaaatctggaggcagacctttataag
cgttttgttctggttctgaatgagaagaaaggaaagattagaagcttacataaattgtta
aaacaagctcagcaaccagaaaaggatacacaagatgaaagggaatctgtagatgatatc
caaagccaaaagaaaagagaggcagcctatgatgaaagtactgatgaggaaagtgaaaat
ttacctgttccttctaaagcagttccagccaattttagccaaaacgattccattatttca
agtccagacgtcacagatattgcaccaagcagaaaaaagaggcagcggttacagaaaaaa
gttgatacagaagctcaatttgttcctcagaaaccaactcttcaagaaaaggaaaaacct
gagtcttcacaacttcagtcatcaagcaaggaacccttctcatctgaaaacatgtcctta
gaaactttaaaaaacagtagtccagaagatctttttgatgatatgtga

DBGET integrated database retrieval system