KEGG   Sarcophilus harrisii (Tasmanian devil): 100914991Help
Entry
100914991         CDS       T02286                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100914991 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100914991 (SPHK1)
   04020 Calcium signaling pathway
    100914991 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100914991 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100914991 (SPHK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100914991 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 457 aa AA seqDB search
MEHASPHPLTWGGAGESPRQPRDPGLGEGDKEPRAEAAGEACVSVAARSPVAASLRVFRT
KVTDAIFSAGHPSRFLPSPCRVLVLLNPRGGTGKALQLFRNRVQPMLQEAGVSFTLRLTE
RRNHARELVREEDLSSWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNA
LAASVNHYAGNEQVTNEDLLTNCTLLLCRRGLSPMNLLSLHTASGSRLFSVLSLGWGFVA
DVDVESEKYRCLGKIRFTLGTFLRLAALRTYQGTLSYLPAGAPSSKISAGSPLGHDQPGP
VDSLLVPLEQPVPENWTVVPEHEFVLVLALLHSHLGSEMYAAPMAQGTGGIIHLFYLRAG
VPRSMLLRLFMAMEKGTHMDLDCPNLVYVPAVAFRLEPHDTRGMLTVDGEQLASEAVQGQ
VHPEGFQLVSGCPELKPSPEPSPLSCSENSASSEFTS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgcgtctcctcaccccttgacttggggcggggcaggagagtccccacgccag
ccccgagatccgggcctgggagagggtgataaggagcctagggcggaggcagccggagag
gcctgtgtttctgtagcggctcggtctccggtggccgcgagcttgagggtgtttcggaca
aaggtcacggatgcaatcttctccgcagggcacccgagccgtttcctgcccagcccctgc
agggttctggtgctcctgaacccccgaggcggaaccggcaaggccctgcagctcttccgc
aacagggtgcagcccatgctgcaggaagcaggtgtctccttcacactgcggctgactgag
cggcggaaccacgcgagggagctggtgcgggaagaggatctctcctcctgggatgccctg
gtggtgatgtctggagatgggctgatgcacgaggtggtgaatggcctcatggaacgaccg
gattgggaaacagcgattcagaagcctctctgtagccttccagcaggctcgggcaatgct
ttggctgcatctgtaaaccattacgcaggcaacgaacaggtgaccaatgaagacctcttg
accaactgtaccctgctgctgtgccgtcgggggctttctcccatgaacctgctttcccta
cacacggcctcgggcagccgcctgttctctgtgctcagcctgggctggggctttgttgca
gacgtagatgtggagagtgaaaagtacaggtgcctagggaaaattcgcttcacgctgggc
acgttcctgcgcctggcggctcttcgcacctatcaaggcacgttatcctatctcccagct
ggagcaccttcctccaagatctccgccggttctcccctgggccatgaccagccaggccct
gtggattcgctcctagtgcctctggagcagccagtgcccgaaaactggaccgtggttcct
gagcacgaatttgtgttggtgctcgctcttctccattcccatctgggaagtgagatgtac
gctgcccccatggctcagggaactggagggattatacatctgttctaccttagggctggc
gtacccagaagtatgttacttcgccttttcatggccatggaaaagggcacacacatggac
ctggactgccccaacctggtgtacgtgcctgcagtcgccttccgactagaaccgcacgat
accaggggcatgcttacagtggatggggagcagctggccagtgaggctgtccaaggccag
gtgcaccctgagggctttcagttggttagtggctgtccagaactaaagcctagcccagag
ccaagccctctatcctgttcagaaaactctgcctcatctgagttcacttcttaa

DBGET integrated database retrieval system