KEGG   Sarcophilus harrisii (Tasmanian devil): 100914991Help
Entry
100914991         CDS       T02286                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shr00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:shr04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:shr04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:shr04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:shr05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 457 aa AA seqDB search
MEHASPHPLTWGGAGESPRQPRDPGLGEGDKEPRAEAAGEACVSVAARSPVAASLRVFRT
KVTDAIFSAGHPSRFLPSPCRVLVLLNPRGGTGKALQLFRNRVQPMLQEAGVSFTLRLTE
RRNHARELVREEDLSSWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNA
LAASVNHYAGNEQVTNEDLLTNCTLLLCRRGLSPMNLLSLHTASGSRLFSVLSLGWGFVA
DVDVESEKYRCLGKIRFTLGTFLRLAALRTYQGTLSYLPAGAPSSKISAGSPLGHDQPGP
VDSLLVPLEQPVPENWTVVPEHEFVLVLALLHSHLGSEMYAAPMAQGTGGIIHLFYLRAG
VPRSMLLRLFMAMEKGTHMDLDCPNLVYVPAVAFRLEPHDTRGMLTVDGEQLASEAVQGQ
VHPEGFQLVSGCPELKPSPEPSPLSCSENSASSEFTS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgcgtctcctcaccccttgacttggggcggggcaggagagtccccacgccag
ccccgagatccgggcctgggagagggtgataaggagcctagggcggaggcagccggagag
gcctgtgtttctgtagcggctcggtctccggtggccgcgagcttgagggtgtttcggaca
aaggtcacggatgcaatcttctccgcagggcacccgagccgtttcctgcccagcccctgc
agggttctggtgctcctgaacccccgaggcggaaccggcaaggccctgcagctcttccgc
aacagggtgcagcccatgctgcaggaagcaggtgtctccttcacactgcggctgactgag
cggcggaaccacgcgagggagctggtgcgggaagaggatctctcctcctgggatgccctg
gtggtgatgtctggagatgggctgatgcacgaggtggtgaatggcctcatggaacgaccg
gattgggaaacagcgattcagaagcctctctgtagccttccagcaggctcgggcaatgct
ttggctgcatctgtaaaccattacgcaggcaacgaacaggtgaccaatgaagacctcttg
accaactgtaccctgctgctgtgccgtcgggggctttctcccatgaacctgctttcccta
cacacggcctcgggcagccgcctgttctctgtgctcagcctgggctggggctttgttgca
gacgtagatgtggagagtgaaaagtacaggtgcctagggaaaattcgcttcacgctgggc
acgttcctgcgcctggcggctcttcgcacctatcaaggcacgttatcctatctcccagct
ggagcaccttcctccaagatctccgccggttctcccctgggccatgaccagccaggccct
gtggattcgctcctagtgcctctggagcagccagtgcccgaaaactggaccgtggttcct
gagcacgaatttgtgttggtgctcgctcttctccattcccatctgggaagtgagatgtac
gctgcccccatggctcagggaactggagggattatacatctgttctaccttagggctggc
gtacccagaagtatgttacttcgccttttcatggccatggaaaagggcacacacatggac
ctggactgccccaacctggtgtacgtgcctgcagtcgccttccgactagaaccgcacgat
accaggggcatgcttacagtggatggggagcagctggccagtgaggctgtccaaggccag
gtgcaccctgagggctttcagttggttagtggctgtccagaactaaagcctagcccagag
ccaagccctctatcctgttcagaaaactctgcctcatctgagttcacttcttaa

DBGET integrated database retrieval system