KEGG   Sarcophilus harrisii (Tasmanian devil): 100914991Help
Entry
100914991         CDS       T02286                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00600  Sphingolipid metabolism
shr01100  Metabolic pathways
shr04020  Calcium signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr05152  Tuberculosis
Module
shr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100914991 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100914991 (SPHK1)
   04371 Apelin signaling pathway
    100914991 (SPHK1)
   04020 Calcium signaling pathway
    100914991 (SPHK1)
   04072 Phospholipase D signaling pathway
    100914991 (SPHK1)
   04071 Sphingolipid signaling pathway
    100914991 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100914991 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100914991 (SPHK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100914991 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100914991
NCBI-ProteinID: XP_012403952
Ensembl: ENSSHAG00000016408
Position
4
AA seq 453 aa AA seqDB search
MEHASPHPLTWGGAGESPRQPRDPGLGEGDKEPRAEAAGEACVSVAARSPVAASLRVFRT
KVTDARHPSRFLPSPCRVLVLLNPRGGTGKALQLFRNRVQPMLQEAGVSFTLRLTERRNH
ARELVREEDLSSWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAAS
VNHYAGNEQVTNEDLLTNCTLLLCRRGLSPMNLLSLHTASGSRLFSVLSLGWGFVADVDV
ESEKYRCLGKIRFTLGTFLRLAALRTYQGTLSYLPAGAPSSKISAGSPLGHDQPGPVDSL
LVPLEQPVPENWTVVPEHEFVLVLALLHSHLGSEMYAAPMAQGTGGIIHLFYLRAGVPRS
MLLRLFMAMEKGTHMDLDCPNLVYVPAVAFRLEPHDTRGMLTVDGEQLASEAVQGQVHPE
GFQLVSGCPELKPSPEPSPLSCSENSASSEFTS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgcgtctcctcaccccttgacttggggcggggcaggagagtccccacgccag
ccccgagatccgggcctgggagagggtgataaggagcctagggcggaggcagccggagag
gcctgtgtttctgtagcggctcggtctccggtggccgcgagcttgagggtgtttcggaca
aaggtcacggatgcaaggcacccgagccgtttcctgcccagcccctgcagggttctggtg
ctcctgaacccccgaggcggaaccggcaaggccctgcagctcttccgcaacagggtgcag
cccatgctgcaggaagcaggtgtctccttcacactgcggctgactgagcggcggaaccac
gcgagggagctggtgcgggaagaggatctctcctcctgggatgccctggtggtgatgtct
ggagatgggctgatgcacgaggtggtgaatggcctcatggaacgaccggattgggaaaca
gcgattcagaagcctctctgtagccttccagcaggctcgggcaatgctttggctgcatct
gtaaaccattacgcaggcaacgaacaggtgaccaatgaagacctcttgaccaactgtacc
ctgctgctgtgccgtcgggggctttctcccatgaacctgctttccctacacacggcctcg
ggcagccgcctgttctctgtgctcagcctgggctggggctttgttgcagacgtagatgtg
gagagtgaaaagtacaggtgcctagggaaaattcgcttcacgctgggcacgttcctgcgc
ctggcggctcttcgcacctatcaaggcacgttatcctatctcccagctggagcaccttcc
tccaagatctccgccggttctcccctgggccatgaccagccaggccctgtggattcgctc
ctagtgcctctggagcagccagtgcccgaaaactggaccgtggttcctgagcacgaattt
gtgttggtgctcgctcttctccattcccatctgggaagtgagatgtacgctgcccccatg
gctcagggaactggagggattatacatctgttctaccttagggctggcgtacccagaagt
atgttacttcgccttttcatggccatggaaaagggcacacacatggacctggactgcccc
aacctggtgtacgtgcctgcagtcgccttccgactagaaccgcacgataccaggggcatg
cttacagtggatggggagcagctggccagtgaggctgtccaaggccaggtgcaccctgag
ggctttcagttggttagtggctgtccagaactaaagcctagcccagagccaagccctcta
tcctgttcagaaaactctgcctcatctgagttcacttcttaa

DBGET integrated database retrieval system