KEGG   Sarcophilus harrisii (Tasmanian devil): 100915007Help
Entry
100915007         CDS       T02286                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 857 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVEK
HYCRTGQRVYLHLQRTRRPKEDETTSGTGDPPRKKPTRLAIGVEGGFDLTEKFEYDEDVK
IVILPDYLEIARDGLGGLPEMARDRITSAVEALLSADSASRKQEVQAWDGEVRQVSKHAF
NLKQLENPARIPPCGWKCSKCDMRENLWLNMTDGSILCGRRYFDGSGGNNHAVEHYKETG
YPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDMN
QRIGEWELIQESSVQLKPLYGPSYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKI
FQNAPSDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKGIQDGIAPRMFKSLI
GKGHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQ
RVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKQPLPELVRAQVPFSSCLEAFGVPEQ
VDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQ
LRGLGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVII
QLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTSTVAD
PPSEDCVATIVSMGFSRDQAMKALRATNNNLERAVDWIFSHIDDLDAEAAMDISEGRSAA
DSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASE
KPPKDLGYIYFYQRMAS
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggcggaattgagtgaggaggcgctgctatctgtattaccgactatccgggtccccaag
gccggagatcgggttcacaaagacgaatgcgccttctctttcgacacgccggagtccgag
ggtggtctgtatatttgcatgaatacctttttgggctttggcaaacagtacgttgagaag
cattactgcaggactggccagcgggtctatcttcacctccagaggactcggcgtccaaaa
gaagatgagaccacttcagggacaggagatccccccagaaagaagccaacgcgcctggct
attggtgtggaaggcgggtttgatctcacagagaagtttgaatatgatgaggatgtgaag
attgtcattttaccagactacctagagattgcccgagatgggctgggaggactgcctgag
atggccagagaccggatcaccagtgcagtggaggccctgttgtcagcagactctgcttca
cggaaacaggaggtacaggcttgggacggggaggtgcggcaagtctccaagcacgccttc
aatctcaagcagctggagaatcctgcccgaatccctccctgtggctggaaatgttccaaa
tgtgatatgcgggaaaacctgtggctcaacatgacagatggttccatactctgcggtcgt
cgatactttgatgggagtgggggcaataaccatgcggtagaacattacaaagaaactggg
tacccgttggcagtgaagcttggcaccatcacacctgatggtgcagatgtttactcatat
gatgaagatgatatggttctggatcccaatctagcagaacacctatcccattttggcatt
gacatgctgaagatgcagaagacagacaaaacaatgacagagctggagatagatatgaac
cagcggattggtgaatgggagttgatccaggagtccagcgtgcaactcaagcccctctat
ggccccagttacacaggcatccgaaacttaggcaatagctgttacctcaactcggtggtt
caagtgctcttcagcatccctgacttccagaggaagtatgtggacaagttggagaagatc
ttccagaatgcaccatccgaccccacccaggacttcagcacccaggtagccaagttgggc
catggccttctctcaggggagtattccaagcctgcaccagaatctggagatggggaacag
gtgccagagcaaaagggaattcaggatggcattgcccctcgaatgttcaagtctctcatt
ggcaaaggtcacccagagttctccaccaaccggcagcaggatgcccaggagttcttcctt
cactttataaatatggttgagaggaattgtcgaagctcagaaaacccaaatgaagtattc
cgattcctggtagaagagaagatcaagtgcctggccacagagaaggtcaagtacacccag
cgagtggactatatcatgcagctgcctgtaccaatggatgcagcccttaacaaagaggag
cttttggagtatgaagagaagaaacgccaagcagaagaggagaagcagcctctgccagag
ctggttcgggcccaggtgccttttagttcctgcctggaggcctttggggtcccagagcag
gtagatgacttctggagcacagccctccaagctaaatctgtagctgtcaagacaacacga
tttgcctcgttccctgactacctggtcatccagatcaagaagtttacctttggcttggac
tgggtgcccaaaaagttagatgtatccattgagatgcccgaggagctggatatctcacag
cttcgggggttagggctgcaacctggagaggaggagctacctgacattgctccacccctg
gtcaccccagatgaacccaaaggtagccttggtttctatggaaacgaagatgaagactcc
ttctgctcccctcacttctcctctccgacatcacccatgttggatgaatctgtcatcatt
cagctggtagagatgggtttccccatggatgcttgccgcaaagctgtctactacactggc
aatagtggggctgaagctgctatgaactgggtcatgtctcatatggatgatccagatttt
gcaaacccacttgtcctgcctggctccagtggtcctggttctaccagcacagtggctgac
cccccctcagaagattgtgtggctactattgtctccatgggcttctccagggaccaggcc
atgaaagcactccgggctacgaacaacaatcttgagcgggctgtagattggatttttagc
cacatcgatgacctggatgcagaggccgctatggacatttcagaggggcgctcagctgca
gattccatctctgagtctgtgcctgtgggacctaaagtccgagatggtcctggaaagtat
cagctctttgccttcatcagtcacatgggcacctctaccatgtgtggtcactatgtctgc
catatcaagaaggagggcaggtgggttatctacaatgatcagaaagtatgtgcctcagag
aagccacccaaggacctgggctatatttacttctaccagagaatggccagctaa

DBGET integrated database retrieval system