KEGG   Sarcophilus harrisii (Tasmanian devil): 100915196Help
Entry
100915196         CDS       T02286                                 

Definition
protein unc-13 homolog C-like
Orthology
K15293  
protein unc-13
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:shr04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1001 aa AA seqDB search
MVSDFFKSLILPYLHKLCKGMFTKKLGNTTKKKQNCPSKKEQDGPLSSQTKPPKFSSTLK
STVKKIAKCSSARNLSREEDEVNRDYSLSPTFSYRVAIANGLQKSILVTNTSNEDLVQEL
SSIESSYSESLSEIKDSTEIKEHSSHTMPVRRNRKSLSSLAPSEGSSDGERTLHNLKLGA
LRKLRKWKKSQEFVSSDSELSAMKKTWGLRSKSLDRTSRPQKTNTLEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKQISHTGSKASLRFLNVPEERFEYVENVVYRILIDKMGFLDAPNTIKIEFA
QRIGQQRDCPNAKPRPILVYFETPQQRDFILKKSYKLKGTGIGVSTDILTHDIRERKDRG
MPTSQTYESMDMKLSTLEPKIKRSSWQSPDDSDKDLDADLNKNSYAVLSKSDFQTKASGP
KSNAKSHNAKSRNKTASSSKFSNKSDYDEQAAQFPKSENLEKESKVYYADMGPLWHSQSD
FLTPKLSRSESDFSKLCQSYSEDFSETPFFTRTNGSSLLSSSDRELWQRRQDGTSNWYSS
SQDQNFNRSIQNDQGPSEIENTETVDSGVSNGVVCISGDRSNYSDSQLSLRDDLSPWKEW
NQSEQGADLGLDSSTQEGFDYDTNSLSDPQLDGDNKDLDDLGKCHSDLPDDSESYDFTLD
DNSSPCPGLDNEIQGQWVGPYDTYQEANSNEPYQNQNQLPMLYRSQSELPSDASEDAAPK
SWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSDVYTEPYYYKAEDEEDYSEPGAEHETDYVEVMEQVLAKLENRTSIPE
MDDNVQEYEHPSYETPYETPQDEGYDGQVDDLMNEEGLEPLNETIIEMEVREDENQNVPE
KPPETPKPKRIRPSFKEAALRAYRKQMAELEEKILAGGTQI
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgacttttttaagagcctgatcttaccctatctccataagctttgtaaagga
atgtttacaaagaaactgggaaacactacaaaaaagaaacaaaattgtcctagcaaaaaa
gagcaagacggtcctctgtctagccagaccaaaccccctaaattttctagcactttgaaa
agcactgttaaaaaaattgctaagtgttcatctgctcgcaacttgtccagagaagaagac
gaagtcaacagggattattccctctctcccacattcagttatcgtgtcgcgattgctaac
ggactgcaaaagagtattcttgtgacaaacactagtaatgaagatctggttcaagagcta
tcatctattgagagctcctactctgaatcattaagtgagatcaaggacagcacggaaatc
aaggagcactcctcacacacaatgcctgtaagacgcaatagaaagagcttgagtagcctg
gctccctcggagggaagctccgacggggagcgcacgttgcataacctgaaactaggagct
ttacgcaaactgaggaaatggaaaaagagccaagaattcgtttcctctgattcagagttg
agcgcaatgaaaaaaacctggggactccgaagcaaatcgttagatagaacttcccgtccc
cagaaaacaaacactctcgaacctgggttcagttcatcaggctgcattagccaaacccat
gatgttatggaaatgatattcaaggaacttcagggaataagccagattgaaacagaactt
tccgaattaagaggccacgtcaatgctctcaaacactctattgatgagatctctagcagc
gtggaggttgtccaaagtgagatagaacaactacgtactggctttgtccagtctcgaagg
gaaaccagagacatccatgattatattaagcaaataagtcatactgggagcaaagcaagt
ttgagatttttaaatgtccctgaagaaagatttgaatatgtggaaaatgtcgtataccgg
attctcatagataaaatgggttttttagatgcacccaatactataaaaattgaatttgct
cagagaatagggcaacagagggattgtccaaatgcgaagcctcgccccatccttgtgtac
tttgaaacacctcaacagagggatttcattttgaaaaaatcttataaacttaaaggaaca
ggcattggagtatcaacagatattctaactcatgacatcagagaaagaaaagacagagga
atgccaacctcccaaacctatgagagtatggacatgaagctctctactcttgagcctaaa
atcaaaaggagcagttggcagtcaccagatgatagtgataaagatctggatgctgatctt
aataaaaacagctatgctgtgctttccaagtcagactttcaaaccaaagcaagtggccca
aagtcaaatgcaaaatctcataatgctaaaagtaggaataaaactgccagcagcagcaaa
ttttcaaataaatcagactatgatgaacaagctgctcagtttcccaaatctgaaaacttg
gagaaggaatccaaagtctattatgctgacatgggtcccctctggcattcccaaagtgac
tttctcacacccaaactgagccgttctgaatctgatttttccaaactttgtcaatcttat
tcagaggatttttcagagactccattttttaccagaacaaatggaagttctctcttatct
tcttcagatagagaactttggcaaagaagacaggatggcacatccaactggtatagcagc
tcccaggaccagaattttaacagaagtattcaaaatgatcaaggtcccagtgaaatagaa
aacaccgaaacagtggacagtggtgtcagtaatggagtagtgtgtatatcgggagacaga
agcaattatagtgattcccagctttctttacgtgatgatctctcaccatggaaagaatgg
aatcagtctgaacaaggagcagatttgggtcttgattcatcaacacaggaaggctttgat
tatgacaccaacagcctgtcagaccctcagctggatggtgacaacaaagatctggatgac
ctaggaaagtgccacagtgaccttccagatgactccgagagctatgattttaccttagat
gacaattcttccccatgcccaggattggataatgaaatacaaggtcagtgggttggccca
tatgatacttatcaggaagccaattctaatgaaccttatcaaaatcaaaatcaactgcca
atgctgtatcggagtcagagtgagttaccgagtgatgcgtcagaggatgctgcccccaaa
tcgtggcatagcagattgagcatagacctttctgataagacattcagctttccaaagttt
gggtccacccttcagcgagctaaatcggctttggaggttgtgtggaacaaaagcactcaa
agcctaagtggatatgaggacagtgggtcttccttaatggggcgatttagaactttatct
cagtctactgcaaatgagtcaagtaccacccttgattcggatgtctacactgaaccatat
tattacaaagcagaggatgaggaagactatagtgaacctggagctgaacatgaaacagat
tatgtagaagtgatggagcaagttcttgctaaactagaaaatagaactagcattcctgaa
atggatgataatgtccaggagtacgaacatccttcatatgaaacaccttatgaaacacca
caggatgaagggtatgatgggcaggtggatgacctgatgaatgaagagggattggaacct
ttaaatgaaacaataattgaaatggaagtaagggaagatgaaaaccagaatgttccggaa
aaacctccagaaacaccaaaacccaagaggattcgtccctcctttaaagaagctgcctta
agggcatacaggaagcagatggcagagctggaggaaaagattctagctggaggtactcaa
atttaa

DBGET integrated database retrieval system