KEGG   Sarcophilus harrisii (Tasmanian devil): 100915301Help
Entry
100915301         CDS       T02286                                 

Gene name
STAMBP
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100915301 (STAMBP)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100915301 (STAMBP)
Peptidases [BR:shr01002]
 Metallo Peptidases
  Family M67
   100915301 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 424 aa AA seqDB search
MPDHGDVSLPPDERVRALIQVGSAVEVNEDVPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFLEKLPKHRDYKTAVIPEKKDTVKKLKEIAFPKAEELKEELLKRYTKEYVE
YIGRKKKETEEFARNLALQQQLEEERQRVAQQKQQQAEQEQFHAFEEMIRRQELEKERLR
IVQEFGKPDPGPEVLGGPLVPGVERPPTEVLPAAPIAPGLPSPGPTPAKPPLVDRSLKPG
ALNSPEHTSAIDGLRHVVVPQMLCPQFLQLADANTVRGVETCGILCGKLMKNEFTITHVL
IPKQSSGPDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFRLTDHGLEEISSCRQKGFHPHCKDPPLFCTCSHVTVVDRAVVM
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccacggggacgtgagcctcccccccgacgagagggtcagagccctcatccag
gtgggcagcgcggtggaggtcaacgaagatgtgccccctcgccggtactttcggtccgga
gtggagattatccgcatggcgtccatttactcggaggagggcaacatcgagcacgccttc
atcctctacaacaaatacatcacgcttttcctcgagaagctcccgaagcacagagactac
aagacggcggtcatcccggaaaagaaggacactgtgaagaaactcaaggagatcgccttt
cccaaagcagaagagttgaaggaggagctgctgaagagatacaccaaagaatatgtggaa
tacattgggagaaagaagaaagaaactgaggagtttgctcgcaacttggccctccagcag
cagctggaggaggaacggcaaagggtggcccagcagaagcagcagcaggcggagcaggaa
cagttccatgcctttgaagagatgatccgtcggcaggaactggaaaaggagcggctgcgg
atagtgcaggagtttgggaagccggacccaggccctgaggttctaggtgggcccctggtg
cccggtgtggagaggccccctacagaggtgctgcctgcagcgcccatagcgccggggctg
cccagcccggggcccacgccagccaagccccctctggtggacaggtccttgaagcctgga
gctctgaacagcccagaacacacatctgcgatagatggcctccgccacgtggtggtgccc
cagatgctctgcccacagttcctccagttggccgacgccaacactgtccgtggcgtggag
acgtgcgggatcctctgtgggaagctgatgaagaatgaattcaccatcacccacgtcctc
atccccaagcagagttcagggcccgattactgcaacacggagaatgaggaggagctgttc
ctcatccaggaccagcagggcctcatcaccctgggttggatacatactcaccccacgcag
acggctttcctgtccagcgtggacctgcacacgcactgctcctaccagatgatgctgcca
gagtcgatcgccattgtctgctcccccaagtttcaggaaacaggattctttaggctgacg
gaccacggactggaggagatctcttcctgtcgccaaaaaggatttcatccccactgcaag
gatccccctctgttctgtacctgcagccacgtgaccgttgtggaccgggcggtcgtcatg
accgacctccgatga

DBGET integrated database retrieval system