KEGG   Sarcophilus harrisii (Tasmanian devil): 100915302Help
Entry
100915302         CDS       T02286                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100915302
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100915302
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100915302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 699 aa AA seqDB search
MKTRQIGTGVPGAEGRSLLLLLLRLLSSLLLLSHAGASSLRYFDNYSLRPDPSYVLEDVA
GLGRVFDGIGGLSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTT
DGTEPSHMHYANDENYFRGYEWWLMKEAKKRNPNIKLIGLPWSFPGWIGHGQNWPYAQPQ
TTALYVVSWILGAKQHHNLDIDYIGIWNERTFDSKYIKVLREVLSQNGLKRVKIIASDYL
WLPISIAMLHDYELMKAVDVIGAHYPGTHTIPEALKTQKILWSSEDYSTFNDEVGGGCWA
RILNQNYVNGNMTATIAWNLVASYYQQLPFGRDGLMTAQEPWSGHYVVESPIWISAHTTQ
FAQPGWQYLKTVGHLVKGGSYVALTDGLGNLTIIIETMTHKHSKCIRPPLPFFNVSEQIA
NFSLSGSFKQLRTLQVWYSKLGDKTGNNSILFKQLPPLKINDGTVTLKLGLDEVYTLTTI
TTGQKGSYPIPPESQPFPTSYKDDFNIRTPPFSEAPNFADQTGVFEYFTNPEQGGDHAFT
LRQVLTQRPITWAADADQTISVIGDYNWKDLVISCDIYIETPHSGGVFIAGRVNKGGEVI
RSAAGIFFWVFADGTYQVTNDLARLLILKKGHANVSAGKWYTLTLNIKDSSVNVILDNTH
LWEGVLPLYPKNGWAAIGTHSFEFAQFDNFHIEATNVHS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcgccagattgggactggcgtcccgggggcggagggtcggtcacttctgctg
ttgctgctgcggctgctttcctcgctgctgcttctgagccatgcgggagcttccagctta
cgatactttgacaattacagtctgcgcccagaccccagttacgtcctggaggatgtcgcc
ggccttggtcgggtgtttgacggcatcggcgggctgagcggcggcggggcaacctcccga
cttctagtcaattatcctgagccatatcgttctgaaatattggattatttatttaagcca
aactttggtgcatctttgcatattctgaaagtggaaataggaggtgatggacaaacaaca
gatggcactgaaccctctcatatgcattatgcaaatgatgagaattatttccggggctat
gaatggtggctaatgaaggaagctaagaagaggaatcccaatattaagcttattgggttg
ccgtggtcatttcctggttggataggtcacggtcaaaactggccctatgcccaaccccaa
actactgctctatatgttgtgtcttggatattgggtgctaaacaacatcacaatttggat
attgattatattgggatttggaatgagagaacatttgacagtaaatatataaaggtatta
agagaagtgctttctcagaatggcctgaaaagagtgaagatcatagccagtgattacctc
tggctgcccatttccattgctatgctacatgattatgaactcatgaaagctgtcgatgtt
atcggggctcattatcctggaactcatactatacctgaagcactgaagacccaaaaaata
ctttggtcttcagaagattacagcactttcaatgatgaagtgggtggaggctgctgggcc
cgtattttgaatcagaactatgtgaatggcaacatgactgccacaattgcttggaatttg
gtggctagttactaccagcaactaccttttgggagagatggattgatgactgctcaggag
ccttggagtggacattatgttgtagagagtcctatctggatttcagctcacaccactcaa
tttgctcaaccaggatggcaatatctaaaaacagttggccatttagtgaaaggtggaagc
tatgttgctcttactgatggcttaggtaacctcactattatcattgaaaccatgactcat
aagcattcaaaatgcataaggccacctcttcctttcttcaatgtgtcagaacaaattgca
aatttctctcttagtggatcctttaaacaattaagaacgttacaggtgtggtattccaaa
ctaggggacaaaactggaaataactctatcttattcaaacaactacctcctctaaagatt
aatgatggtacagtcacattaaaattgggtctggatgaagtatatactttaacaactatc
actacaggtcagaaaggcagttatcctattcctccagagtcacaaccatttccaacaagc
tataaagatgatttcaacattcgtactccaccttttagtgaagctccgaattttgctgat
cagacgggagtttttgagtacttcaccaatcccgagcaagggggggaccatgccttcact
ttacgccaagtgctcactcagcgacctatcacctgggctgctgatgcagatcagaccatc
agtgttataggggattataactggaaggatctggtaataagttgtgatatctacatagag
acaccacatagtggtggtgtattcattgctggaagagtaaataaaggtggggaagtcatc
cgaagcgctgcaggaattttcttctgggtttttgcagatgggacctaccaagttacaaat
gatcttgctagactgttgatattaaagaaaggacatgctaatgttagtgctgggaaatgg
tacaccctcactctgaatattaaagactcttctgttaatgtcatactagataatacacat
ctctgggaaggtgtgctacccttatatcccaagaatggttgggcagcaattggaacacat
agctttgagtttgcacagtttgacaactttcatatagaggctacaaatgtgcattcttga

DBGET integrated database retrieval system