KEGG   Sarcophilus harrisii (Tasmanian devil): 100915302Help
Entry
100915302         CDS       T02286                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shr00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 699 aa AA seqDB search
MKTRQIGTGVPGAEGRSLLLLLLRLLSSLLLLSHAGASSLRYFDNYSLRPDPSYVLEDVA
GLGRVFDGIGGLSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTT
DGTEPSHMHYANDENYFRGYEWWLMKEAKKRNPNIKLIGLPWSFPGWIGHGQNWPYAQPQ
TTALYVVSWILGAKQHHNLDIDYIGIWNERTFDSKYIKVLREVLSQNGLKRVKIIASDYL
WLPISIAMLHDYELMKAVDVIGAHYPGTHTIPEALKTQKILWSSEDYSTFNDEVGGGCWA
RILNQNYVNGNMTATIAWNLVASYYQQLPFGRDGLMTAQEPWSGHYVVESPIWISAHTTQ
FAQPGWQYLKTVGHLVKGGSYVALTDGLGNLTIIIETMTHKHSKCIRPPLPFFNVSEQIA
NFSLSGSFKQLRTLQVWYSKLGDKTGNNSILFKQLPPLKINDGTVTLKLGLDEVYTLTTI
TTGQKGSYPIPPESQPFPTSYKDDFNIRTPPFSEAPNFADQTGVFEYFTNPEQGGDHAFT
LRQVLTQRPITWAADADQTISVIGDYNWKDLVISCDIYIETPHSGGVFIAGRVNKGGEVI
RSAAGIFFWVFADGTYQVTNDLARLLILKKGHANVSAGKWYTLTLNIKDSSVNVILDNTH
LWEGVLPLYPKNGWAAIGTHSFEFAQFDNFHIEATNVHS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcgccagattgggactggcgtcccgggggcggagggtcggtcacttctgctg
ttgctgctgcggctgctttcctcgctgctgcttctgagccatgcgggagcttccagctta
cgatactttgacaattacagtctgcgcccagaccccagttacgtcctggaggatgtcgcc
ggccttggtcgggtgtttgacggcatcggcgggctgagcggcggcggggcaacctcccga
cttctagtcaattatcctgagccatatcgttctgaaatattggattatttatttaagcca
aactttggtgcatctttgcatattctgaaagtggaaataggaggtgatggacaaacaaca
gatggcactgaaccctctcatatgcattatgcaaatgatgagaattatttccggggctat
gaatggtggctaatgaaggaagctaagaagaggaatcccaatattaagcttattgggttg
ccgtggtcatttcctggttggataggtcacggtcaaaactggccctatgcccaaccccaa
actactgctctatatgttgtgtcttggatattgggtgctaaacaacatcacaatttggat
attgattatattgggatttggaatgagagaacatttgacagtaaatatataaaggtatta
agagaagtgctttctcagaatggcctgaaaagagtgaagatcatagccagtgattacctc
tggctgcccatttccattgctatgctacatgattatgaactcatgaaagctgtcgatgtt
atcggggctcattatcctggaactcatactatacctgaagcactgaagacccaaaaaata
ctttggtcttcagaagattacagcactttcaatgatgaagtgggtggaggctgctgggcc
cgtattttgaatcagaactatgtgaatggcaacatgactgccacaattgcttggaatttg
gtggctagttactaccagcaactaccttttgggagagatggattgatgactgctcaggag
ccttggagtggacattatgttgtagagagtcctatctggatttcagctcacaccactcaa
tttgctcaaccaggatggcaatatctaaaaacagttggccatttagtgaaaggtggaagc
tatgttgctcttactgatggcttaggtaacctcactattatcattgaaaccatgactcat
aagcattcaaaatgcataaggccacctcttcctttcttcaatgtgtcagaacaaattgca
aatttctctcttagtggatcctttaaacaattaagaacgttacaggtgtggtattccaaa
ctaggggacaaaactggaaataactctatcttattcaaacaactacctcctctaaagatt
aatgatggtacagtcacattaaaattgggtctggatgaagtatatactttaacaactatc
actacaggtcagaaaggcagttatcctattcctccagagtcacaaccatttccaacaagc
tataaagatgatttcaacattcgtactccaccttttagtgaagctccgaattttgctgat
cagacgggagtttttgagtacttcaccaatcccgagcaagggggggaccatgccttcact
ttacgccaagtgctcactcagcgacctatcacctgggctgctgatgcagatcagaccatc
agtgttataggggattataactggaaggatctggtaataagttgtgatatctacatagag
acaccacatagtggtggtgtattcattgctggaagagtaaataaaggtggggaagtcatc
cgaagcgctgcaggaattttcttctgggtttttgcagatgggacctaccaagttacaaat
gatcttgctagactgttgatattaaagaaaggacatgctaatgttagtgctgggaaatgg
tacaccctcactctgaatattaaagactcttctgttaatgtcatactagataatacacat
ctctgggaaggtgtgctacccttatatcccaagaatggttgggcagcaattggaacacat
agctttgagtttgcacagtttgacaactttcatatagaggctacaaatgtgcattcttga

DBGET integrated database retrieval system