KEGG   Sarcophilus harrisii (Tasmanian devil): 100915387Help
Entry
100915387         CDS       T02286                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 263 aa AA seqDB search
MAYLGLLCCFAFIGASLGCGVPTIEPVLSGLARIVNGEEAVPGSWPWQVSLQDTTGFHFC
GGSIISEDWVVTAAHCGVKKTDLVIAGEFDQGSDEENIQVLKIGQVFRNPKFNFFTITND
ITLIKLATPVQFSDTVSPVCLPNSAEDFPAGSNCVTTGWGLTKHTNNKTPERLQQAALPL
LSNSECQKYWGSKIKDTMICAGASGVSSCMGDSGGPLVCQKNGAWTLVGIVSWGSSTCST
SSPGVYARVTELMPWVQEILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcctacctgggactcttatgctgttttgccttcattggcgcctctttaggctgtggt
gttcctaccatcgaacccgtcctgagtggcctggctaggatcgtcaatggtgaagaggct
gtccctggctcctggccctggcaggtttcccttcaggacacaactggcttccacttttgc
gggggatcaatcatcagtgaagattgggtggtcactgctgctcactgtggtgtcaagaaa
actgacctggtgattgctggtgagtttgaccaaggttccgatgaggagaacatccaagtg
ctgaagattggccaggttttccggaatcccaaattcaacttcttcaccatcaccaatgac
atcactctgatcaagctggccacacctgtccagttttcagacacagtgtcccccgtctgc
cttcccaactctgctgaggacttccctgcaggctccaactgtgtcaccaccggctggggg
ctgaccaagcacaccaacaacaaaacccctgagaggctccagcaagctgctctgcccctc
ctgtccaacagtgaatgccagaagtactggggtagcaagatcaaggacactatgatctgc
gctggtgccagtggtgtttcctcctgcatgggtgactccggcggcccactggtctgccag
aagaatggcgcctggaccctggttggtatcgtctcttggggcagtagcacctgttccacc
tccagccctggtgtgtatgcccgggtcacagaactcatgccctgggtgcaagagatcctg
gctgccaactga

DBGET integrated database retrieval system