KEGG   Sarcophilus harrisii (Tasmanian devil): 100915447Help
Entry
100915447         CDS       T02286                                 

Definition
(RefSeq) cytochrome P450 2C19-like
  KO
K17721  
cytochrome P450, family 2, subfamily C, polypeptide 19 [EC:1.14.13.48 1.14.13.49 1.14.13.80 1.14.13.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100915447
   00591 Linoleic acid metabolism
    100915447
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100915447
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100915447
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100915447
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.48  (S)-limonene 6-monooxygenase
     100915447
    1.14.13.49  (S)-limonene 7-monooxygenase
     100915447
    1.14.13.80  (R)-limonene 6-monooxygenase
     100915447
    1.14.13.-  
     100915447
Cytochrome P450 [BR:shr00199]
 Cytochrome P450, animal type
  CYP2 family
   100915447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 494 aa AA seqDB search
MDPSVVTALSVILCLLLISVWRKGYGKGKLPPGPTPFPIIGNILQLDTKNINKSFCLLAK
AYGPVFTLYLGSKRAIVLHGYEAIKEALIGHGDAFAGRGSFPISDTINKGFGLLFSNGER
WKQIRRFSLMTLRNFGMGKRSIEERVQEEAKCLVEELKKTNGLPCDPTTILESAPCNVIC
SVVFQKRIEYQDEKFQRLMENLNENIRILSSPWIQVYNLFPSLVHYLPGIHHKLIENFRY
MNDFVLERVKEHQETLNANDPRDFIDCFLMKVEEEKQNPQSEFTIENLVYTTLDLFGAGT
ETTSTTLRYGLLLLLKHPHITKKIHEEIDRVIGPNQSPCMKDRNNMPYTNAVIHEIQRYI
DLVPASLPHAVTQDIQFRQYLIPKGTTIIPLLTSVLYDNEEFPNPDQFDPHHFLDESGNF
KKSNYFLPFSIGKRACVGEGLAQMELFLFFTTILQNFTLKPVTDLKDIDVTPVDNGFNHV
PPCYEICFLPSKNM
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatccatctgtggtcactgctctcagcgtgatactctgtctacttctcatttcagta
tggagaaagggctatggaaaaggaaagttaccacctggacctactccttttccaattatt
ggaaatatattgcaattagatactaagaatatcaataaatccttttgcctgctggcaaaa
gcttatggcccagtattcactttgtatttgggttctaagcgagctatcgtgttgcatgga
tatgaagcaattaaggaagctctgattggtcatggagatgcatttgctggcagaggaagt
ttcccaatatctgatactattaacaagggattcggactccttttcagtaacggagagaga
tggaagcaaattcgccgcttctcacttatgaccctgaggaattttggaatggggaagagg
agcattgaggaacgagtccaagaagaggcaaagtgcctagtggaagagttaaaaaaaaca
aatggtctgccttgtgatcccaccaccatccttgagtctgccccctgtaatgtcatctgc
tcagttgttttccagaaacgtattgaatatcaagatgagaaatttcagcgtttaatggaa
aatttaaatgaaaatatcaggattcttagctccccatggatacaggtctacaatcttttc
ccatctttagtccattatctcccaggaattcatcataaattaatcgaaaactttcgttac
atgaatgactttgttttggagagagtgaaggaacatcaagaaaccttgaatgctaatgac
cctcgggacttcattgattgtttcctgatgaaagtagaggaggaaaagcaaaatccacaa
tctgagtttactattgaaaacctagtctataccactcttgatctttttggagccgggaca
gagaccaccagcaccactttgagatatggcctcctgcttctgctgaagcaccctcacata
acaaaaaaaatccatgaagaaatcgaccgagtgattggcccaaaccaaagtccctgcatg
aaagacagaaacaatatgccttataccaatgctgtgatccatgaaatacagagatatata
gaccttgttcctgccagcctgcctcatgcagtaacacaagacattcagttcagacaatac
ctcattcccaagggcaccaccataataccattgctgacttctgttctctatgacaatgaa
gagttccccaatccagatcagtttgacccacatcatttcctggatgaaagtggcaacttt
aagaaaagcaattattttttacctttttcaataggaaaacgggcatgtgttggcgagggc
ttggctcagatggaattgtttctcttttttaccaccatcctacaaaattttaccttgaag
cccgtcactgacctcaaagacattgatgtcactccagttgacaatgggtttaaccacgtg
ccgccctgttacgagatctgcttcctaccttccaagaatatgtaa

DBGET integrated database retrieval system