KEGG   Sarcophilus harrisii (Tasmanian devil): 100915455Help
Entry
100915455         CDS       T02286                                 

Definition
protein unc-13 homolog C-like
Orthology
K15293  
protein unc-13
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100915455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1158 aa AA seqDB search
MINSVGLGVMIPVCELCQITFCNWLLDLEERRHQSRQVCPCSLLTPGILEAVLVFDTFLV
EQGIRLLLQARIVSGSGLDASQFSALQAFGVGRGLYGIDSMPDLRRKKTLPIVRDVAMTL
AARKSGISLAMVIRTSLNNEELKMHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYEC
EGLLWGIARQGMKCMECGVKCHEKCQDLLNADCLQSDECHNSTDRIKVRVWDEDDDIKSR
VKQHFKKESDDFLGQTIVEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKV
APYHIQYTCLHENLFHYLTEVKFNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIE
SIYQAMTHFSCLSSKYMCPGVPAVMSTLLANINAFYAHPTVSTNVQVSASDRFAATNFGR
EKFIKLLDQLHNSLRIDLSKYRDNFPASNSERLQDLKSTVDLLTSITFFRMKVLELQSPP
RASTVVKDCVRACLDSTYKYIFDNCHELYTQLIDPSKKQDIPREDQGPTVKNLDFWPQLI
TLMVTIIDEDKTAYTPVLNQFPQELNMGKVSAEIMWTLFAQDIKYALEEHEKQRLCKSTD
YMNLHFKVKWFYNEYVRELSAFKDAVPEYSLWFEPFVIQWLDENEDVSMEFLHGALGRDK
KDGFQQTSDHALFSCSVVDVFAQLNQSFEIIKKLECPNPEALSHLMRRFAKTISKVLLQY
AAIVSNDFSSYCDKENVPCILMNNIQQLRVQLEKMFESMGGKELDPEASSVLKELQVKLN
GVLDELSITYGESFQLIIEECVKQMSLELNQMKGNGNTTSNKNNAAMDAEIVLRPLMDFL
DKTLSLSAKICEKTVLKRVLKELWKLVLNKIEKQIVLPPLTDQTGPQMIFSAAKDLGQLS
KLKDHMIREEAKGLTLRQCAVMEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSL
YTQTTDSLIKKFIDTQTSQNRSRNDSVGQISVHVDISTIPGTGEHKVIVKVIAINDLHWQ
TTAMFRPFVEVFILGPNLGDKKRKQGTKTKSNTWSPKYNETFQFILSNENRPGAYELHLS
VKDYCFAREDRVIGMTVIQLQNIVEKGSSGAWYPLLKNIFMDDTGLTILRILSQRTNDDV
AKEFVRLKSDTRSTEEIA
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgataaatagtgttggacttggagtcatgattcctgtatgtgaattgtgtcagatcaca
ttttgtaactggctccttgatctggaggaaagaaggcaccagagcagacaggtctgtcca
tgttccctactcacaccaggcatcttggaagctgtgcttgtatttgacacctttctggta
gagcagggtatcagattgctgctacaggctcgaatagtaagtggaagtggtctggatgct
tcccaattcagtgcgctccaagcatttggagttgggaggggactctatggtattgacagc
atgcctgatctccggaggaaaaaaaccttgcccattgttagagatgtggccatgacatta
gctgcccgaaaatctggaatctccctggccatggttattaggacatctctgaacaatgaa
gaattgaaaatgcatgtcttcaaaaagactctacaagcattgatctatccgatgtcatcc
accacccctcacaattttgaggtttggacagctaccaccccaacctactgctatgaatgt
gaaggtcttctttggggaatagcgagacaaggcatgaagtgtatggagtgtggtgtcaaa
tgtcatgaaaagtgtcaggatcttctaaatgctgactgtttgcagagtgatgaatgccat
aactctaccgaccgaatcaaagtcagagtatgggatgaagatgatgatattaaatccaga
gtcaagcagcatttcaaaaaagaatcagatgatttcttgggacaaacaattgttgaagtg
cgaacactgagtggagaaatggatgtctggtacaacctagagaaacggacagataaatca
gctgtatctggtgccattaggttgaaaatcaatgttgaaataaaaggggaggagaaggtt
gcaccatatcatatacagtacacatgtttgcatgagaacctgttccattacttgactgaa
gttaaatttaatggtggagtgaaaatcccagaagtcaaaggagatgaagcttggaaggtt
ttctttgatgatgcgtcccaagaaatcgtagatgaatttgcaatgcgttatggaattgag
tctatttatcaagcaatgacgcacttttcatgtctgtcttccaagtacatgtgtcctggt
gtcccagcagtgatgagtaccctcctggcaaacataaatgctttttatgcccatccaaca
gtctcaactaatgtgcaggtatctgcctcagatcggtttgctgctaccaactttggtaga
gaaaagttcattaaactactggatcaattgcacaactctttgaggattgatttgtcaaag
tacagggacaactttcctgctagcaattcagagagacttcaagatctgaaatcaactgtt
gacctactaacaagcatcaccttttttcgaatgaaggttttagaactccaaagtccacca
agggccagcactgttgtaaaggactgtgtcagagcttgtttagactccacatataagtat
atttttgacaactgccatgaactctacacacagcttatagatccgagtaagaaacaagac
attcctcgggaagatcagggtccaaccgtcaagaatttggatttttggccccagctcatc
actttgatggtcacaattattgatgaagataaaactgcatacacacctgtcctgaatcag
ttccctcaagaactaaacatgggaaaagtcagtgctgagatcatgtggaccctctttgcg
caggatattaagtatgccctggaagaacatgaaaagcaacggttatgcaagagtaccgat
tatatgaatttgcatttcaaagtaaaatggttttataatgaatatgtgcgagagctctct
gccttcaaggatgctgttcctgaatactctttatggtttgagccttttgtcatccagtgg
cttgatgaaaatgaagatgtatcaatggaattccttcatggtgctctaggaagagacaaa
aaagatggattccagcagacctcagaccatgccctcttctcttgctccgtagtagatgtc
tttgcacagcttaatcaaagcttcgagattatcaagaaattggagtgccctaatcctgaa
gcattatcccatttaatgagaagatttgcaaagactatcagtaaagttctactccagtat
gctgcaattgtctccaatgatttcagttcatattgtgataaagaaaatgtgccctgtatt
ttgatgaataacattcaacaattacgagtccagctggaaaaaatgtttgaatccatggga
gggaaagagctagatcctgaagctagtagtgttctcaaagaacttcaggtaaaactcaac
ggggtcctggatgagctcagcataacctacggtgaaagtttccagctcataattgaagaa
tgcgtgaagcaaatgagtttagaattgaatcaaatgaaaggaaatggaaataccacctcc
aacaagaacaatgcagctatggacgcagaaattgttctacgacctcttatggacttcttg
gacaaaactttaagtctctctgcgaaaatctgtgaaaagacagtgctgaagcgggttttg
aaagaactatggaagcttgtcctcaacaaaatagaaaagcagattgttcttcctcctttg
acagatcaaacaggaccccaaatgattttcagtgcagctaaggatcttggacagctatct
aaattaaaggatcacatgattcgagaagaagccaagggtctgaccctaagacagtgtgct
gttatggaagtagtcttggccacaatcaagcaatactttcacgctggaggaaatggtctg
aaaaagaactttttggagaagagccctgatcttcagtctcttagatatgctctgagtctt
tatacccaaacgaccgattccctgataaagaaattcatcgacactcagacctctcagaat
cgttcccggaatgattcagtaggacagatatcagttcatgtggacatctccaccattcca
ggaactggggagcataaagtgattgtaaaagtcatcgccattaatgacttacactggcaa
accacagcaatgtttcgcccctttgtggaggtttttatactgggacccaaccttggtgac
aagaaaaggaaacaaggtaccaagaccaaaagcaacacctggtcacccaagtacaacgaa
actttccagttcatcctgagtaatgaaaatcgcccgggggcctacgagcttcacctttct
gttaaagattattgctttgcccgggaagatcgagttataggaatgacagtgattcaactc
cagaatatagtggagaaagggagctctggggcatggtatccgctattgaaaaacatcttt
atggatgacactggcttgacaatccttagaatactttctcaaaggaccaatgatgatgtg
gctaaagaatttgtgagactgaaatctgatacaagatccacagaagagattgcctga

DBGET integrated database retrieval system