KEGG   Sarcophilus harrisii (Tasmanian devil): 100915460Help
Entry
100915460         CDS       T02286                                 

Definition
ubiquitin carboxyl-terminal hydrolase 11-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100915460
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100915460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 935 aa AA seqDB search
MEAAGRRAAVEFLVEQHWYQQWEAYVRGGDQDSSAFPGPVNNAELFEDQETWRLKERLVE
GEDYVLLPAMAWHLLVNWYGLEPGQPPIERKVVELPSTHKVEVYLVELLLCQHNDMEISR
PAQFSRADPVELVLHTAREQFLVGPDEETRLWVKNADGSCERLRNIHMSVLDACLGPGQV
VIMETRNKDGTWPSSRPHIMKSVSDEEDGFRGQPGVCGLTNLGNTCFMNSALQCLSNVPP
LTEYFLHNHYLKELNFCNPLGMKGEIAEAYADLVKQAWSGHHRSVVPRMFKTKVGHFASQ
FLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELRDAAGRPDQEVADEAWRNHKRRNDS
VIVDTFHGLFKSTLVCPECGKVSVTFDPFCYLSVPLPVSKERGMEVFFVSMDPRRKPEQH
RLVVPKAGKVLDLCVALAKHTGVSPDRMMVADVFSHRFYKIYQLEESLSCILDRDDIFVY
EVSGGAGGGEGTGEDVVLPVYLRERTPARDYSDSYYGLMLFGHPLLVSVPRDRLSWDALY
HILLHRLSRYVTRPESDDEEDDDDDDDDDDEEEDDDEDDDDEEEEEDNSEDDEEEEEEDD
EEDLYKRPSRLSEGEEDEEEERGGSTLDVRPSTEGSGATSGVQVGEVEGEGPPPSPPPSP
PPGPAKRPRRRRRRRRRRRPRRKVLFSLHTVNSNGTSDRRGFAEDANAQPYIAIDWEPDM
KKRYYNEVEAEGYVKHDCMGYVLRKAPVRLQECIELFTTVETLEEENPWYCPTCKRHQLA
TKKLDLGALPEALIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFIIKPRTEADPTPCK
YDLIAVSNHYGGLRDGHYTTFARNKDSGQWHYFDDSSVSPVSESQIESKAAYVLFYQRQD
KVRRSPTRPGAASTVSTPPGDGPGPCPRAEPMDMD
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgctgggagaagggctgcagtggagttcctggtggaacaacactggtaccag
cagtgggaggcctatgtccgaggtggagaccaggactctagcgccttcccggggcctgtc
aacaatgcggagctcttcgaagaccaagaaacctggcgtctgaaggaacggctggtggaa
ggcgaggactatgtgctgctgccagccatggcctggcatcttctggttaactggtatggg
ctggagcccgggcagccacccatcgagcggaaggtggtagagctgcccagcacccacaag
gtagaagtctacctagtagagctgctcctgtgtcagcacaatgacatggaaatatcccgg
cctgcccagttcagccgtgcagaccctgttgagttggtccttcatacggccagggagcaa
ttcttagtggggccagacgaggagacacgcctgtgggtgaagaatgcagatggatcctgc
gagagactgaggaatatacatatgtctgtgttagatgcctgccttgggcctggtcaggtc
gtcatcatggagacgaggaacaaagatggcacgtggcctagctcccggcctcacatcatg
aagagcgtgtcagatgaggaggacggcttccggggccagccaggtgtctgtggtctcacc
aacctgggcaacacgtgcttcatgaactcggccctacagtgcttgagcaatgtccccccg
ctgacggaatacttcctccacaaccactacttaaaggagctgaatttctgcaatcccctt
ggcatgaagggcgagatcgctgaggcctacgctgacctggtcaaacaggcctggtctggc
caccaccgctctgtggtcccccggatgttcaagacgaaggtcggccactttgcgtcccag
ttccttggctaccagcagcatgactcccaggagttgctctccttcctgctcgatggtctg
cacgaggacctgaaccgggtcaagaagaaggagtacgtggagcttcgggatgctgctgga
cggcccgaccaggaggtggcagatgaagcctggagaaatcataagcgtcggaatgattct
gtaattgtggacacattccatgggctcttcaagtcaacattggtctgccccgagtgtgga
aaggtgtctgtaacctttgaccccttctgctacctgagtgttcctctgcctgtgagcaaa
gaacgtggcatggaggtcttcttcgtttctatggacccacgccgaaaacccgagcagcat
cgtctggttgtgcccaaggcagggaaagtgttggatctctgtgtcgccctggctaagcac
acgggcgtctctccggaccggatgatggtggcagatgtgttcagtcatcgcttctacaag
atctaccagctggaggagtctctgagctgtatcctggatcgggatgacatctttgtgtac
gaggtgtctggcggggctggtggcggagagggcacgggagaggacgtggtgctgcccgtc
taccttcgggagcggaccccagcccgggactacagcgactcctattacggcctcatgctt
ttcggacaccctctactggtgtctgtgccccgtgaccgactctcctgggacgccctctac
catattctgctacatcgcctctcgcgctacgtcacccgacccgaatcggacgacgaggag
gacgacgacgacgacgatgacgatgacgacgaggaagaggacgacgacgaggatgacgac
gacgaggaggaggaggaagacaacagtgaagatgatgaggaggaggaagaggaggacgac
gaagaagatctgtataagcgtcccagcaggctgagtgagggcgaggaagatgaggaagag
gagaggggggggagtaccttggatgtccggccctctacagagggctcaggggcaaccagc
ggggttcaggtaggggaggtagagggggagggccctcctcccagtccccctcccagtccc
cctcccggccccgcgaagaggccaagaaggaggcggcgccgccggcggcggaggaggccc
cggcggaaggtcctcttcagcctccacaccgtgaattccaacggaaccagtgaccgcaga
ggctttgccgaagatgccaacgcccagccatacatcgccatcgactgggagcccgacatg
aagaagcgctactacaatgaggtggaagccgagggctacgtgaaacacgactgcatgggc
tacgtgctgaggaaggcccctgtgcgccttcaggagtgcatcgagctgttcactaccgtg
gagactttggaagaagagaatccttggtactgcccgacctgtaagcgccatcagctggcc
accaagaagctggatttgggggccctccccgaggccctcatcatccacctgaagcgtttc
tcctacaccaagttttcccgtgagaagctggacacgctggtcgagtttcccatccgggac
ctcgatttctctgagtttatcatcaaaccaaggactgaggctgacccgacaccctgcaaa
tatgacctcatcgccgtctcgaaccactacgggggcctgcgagatgggcactacaccaca
ttcgcccggaacaaggacagcggccagtggcattactttgatgacagcagcgtctcgccc
gtatctgagagtcagattgagtccaaggcggcctatgttctattctatcagcggcaggac
aaggtgcggcggtccccaacccgacctggtgcggccagcacggtctctacaccccctggt
gatgggccaggcccctgtccccgggccgagcccatggacatggactga

DBGET integrated database retrieval system