KEGG   Sarcophilus harrisii (Tasmanian devil): 100915460Help
Entry
100915460         CDS       T02286                                 

Gene name
USP11
Definition
(RefSeq) ubiquitin specific peptidase 11
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100915460 (USP11)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100915460 (USP11)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100915460 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 970 aa AA seqDB search
MAGVASGSGAKEEHGELGLGAARQALTPPPPALLASRPSPRFLVEQHWYQQWEAYVRGGD
QDSSAFPGPVNNAELFEDQETWRLKERLVEGEDYVLLPAMAWHLLVNWYGLEPGQPPIER
KVVELPSTHKVEVYLVELLLCQHNDMEISRPAQFSRADPVELVLHTAREQFLVGPDEETR
LWVKNADGSCERLRNIHMSVLDACLGPGQVVIMETRNKDGTWPSSRPHIMKSVSDEEDGF
RGQPGVCGLTNLGNTCFMNSALQCLSNVPPLTEYFLHNHYLKELNFCNPLGMKGEIAEAY
ADLVKQAWSGHHRSVVPRMFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKK
EYVELRDAAGRPDQEVADEAWRNHKRRNDSVIVDTFHGLFKSTLVCPECGKVSVTFDPFC
YLSVPLPVSKERGMEVFFVSMDPRRKPEQHRLVVPKAGKVLDLCVALAKHTGVSPDRMMV
ADVFSHRFYKIYQLEESLSCILDRDDIFVYEVSGGAGGGEGTGEDVVLPVYLRERTPARD
YSDSYYGLMLFGHPLLVSVPRDRLSWDALYHILLHRLSRYVTRPESDDEEDDDDDDDDDD
EEEDDDEDDDDEEEEEDNSEDDEEEEEEDDEEDLYKRPSRLSEGEEDEEEERGGSTLDVR
PSTEGSGATSGVQVGEVEGEGPPPSPPPSPPPGPAKRPRRRRRRRRRRRPRRKVLFSLHT
VNSNGTSDRRGFAEDANGVSFNSQPYIAIDWEPDMKKRYYNEVEAEGYVKHDCMGYVLRK
APVRLQECIELFTTVETLEEENPWYCPTCKRHQLATKKLDLGALPEALIIHLKRFSYTKF
SREKLDTLVEFPIRDLDFSEFIIKPRTEADPTPCKYDLIAVSNHYGGLRDGHYTTFARNK
DSGQWHYFDDSSVSPVSESQIESKAAYVLFYQRQDKVRRSPTRPGAASTVSTPPGDGPGP
CPRAEPMDMD
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtggcctccggctccggggcgaaagaggagcacggcgaactggggctgggc
gcagcacgtcaggctctgacccctccccctcccgctctgctcgcctcccgcccctccccc
aggttcctggtggaacaacactggtaccagcagtgggaggcctatgtccgaggtggagac
caggactctagcgccttcccggggcctgtcaacaatgcggagctcttcgaagaccaagaa
acctggcgtctgaaggaacggctggtggaaggcgaggactatgtgctgctgccagccatg
gcctggcatcttctggttaactggtatgggctggagcccgggcagccacccatcgagcgg
aaggtggtagagctgcccagcacccacaaggtagaagtctacctagtagagctgctcctg
tgtcagcacaatgacatggaaatatcccggcctgcccagttcagccgtgcagaccctgtt
gagttggtccttcatacggccagggagcaattcttagtggggccagacgaggagacacgc
ctgtgggtgaagaatgcagatggatcctgcgagagactgaggaatatacatatgtctgtg
ttagatgcctgccttgggcctggtcaggtcgtcatcatggagacgaggaacaaagatggc
acgtggcctagctcccggcctcacatcatgaagagcgtgtcagatgaggaggacggcttc
cggggccagccaggtgtctgtggtctcaccaacctgggcaacacgtgcttcatgaactcg
gccctacagtgcttgagcaatgtccccccgctgacggaatacttcctccacaaccactac
ttaaaggagctgaatttctgcaatccccttggcatgaagggcgagatcgctgaggcctac
gctgacctggtcaaacaggcctggtctggccaccaccgctctgtggtcccccggatgttc
aagacgaaggtcggccactttgcgtcccagttccttggctaccagcagcatgactcccag
gagttgctctccttcctgctcgatggtctgcacgaggacctgaaccgggtcaagaagaag
gagtacgtggagcttcgggatgctgctggacggcccgaccaggaggtggcagatgaagcc
tggagaaatcataagcgtcggaatgattctgtaattgtggacacattccatgggctcttc
aagtcaacattggtctgccccgagtgtggaaaggtgtctgtaacctttgaccccttctgc
tacctgagtgttcctctgcctgtgagcaaagaacgtggcatggaggtcttcttcgtttct
atggacccacgccgaaaacccgagcagcatcgtctggttgtgcccaaggcagggaaagtg
ttggatctctgtgtcgccctggctaagcacacgggcgtctctccggaccggatgatggtg
gcagatgtgttcagtcatcgcttctacaagatctaccagctggaggagtctctgagctgt
atcctggatcgggatgacatctttgtgtacgaggtgtctggcggggctggtggcggagag
ggcacgggagaggacgtggtgctgcccgtctaccttcgggagcggaccccagcccgggac
tacagcgactcctattacggcctcatgcttttcggacaccctctactggtgtctgtgccc
cgtgaccgactctcctgggacgccctctaccatattctgctacatcgcctctcgcgctac
gtcacccgacccgaatcggacgacgaggaggacgacgacgacgacgatgacgatgacgac
gaggaagaggacgacgacgaggatgacgacgacgaggaggaggaggaagacaacagtgaa
gatgatgaggaggaggaagaggaggacgacgaagaagatctgtataagcgtcccagcagg
ctgagtgagggcgaggaagatgaggaagaggagaggggggggagtaccttggatgtccgg
ccctctacagagggctcaggggcaaccagcggggttcaggtaggggaggtagagggggag
ggccctcctcccagtccccctcccagtccccctcccggccccgcgaagaggccaagaagg
aggcggcgccgccggcggcggaggaggccccggcggaaggtcctcttcagcctccacacc
gtgaattccaacggaaccagtgaccgcagaggctttgccgaagatgccaacggcgtctcc
tttaactcccagccatacatcgccatcgactgggagcccgacatgaagaagcgctactac
aatgaggtggaagccgagggctacgtgaaacacgactgcatgggctacgtgctgaggaag
gcccctgtgcgccttcaggagtgcatcgagctgttcactaccgtggagactttggaagaa
gagaatccttggtactgcccgacctgtaagcgccatcagctggccaccaagaagctggat
ttgggggccctccccgaggccctcatcatccacctgaagcgtttctcctacaccaagttt
tcccgtgagaagctggacacgctggtcgagtttcccatccgggacctcgatttctctgag
tttatcatcaaaccaaggactgaggctgacccgacaccctgcaaatatgacctcatcgcc
gtctcgaaccactacgggggcctgcgagatgggcactacaccacattcgcccggaacaag
gacagcggccagtggcattactttgatgacagcagcgtctcgcccgtatctgagagtcag
attgagtccaaggcggcctatgttctattctatcagcggcaggacaaggtgcggcggtcc
ccaacccgacctggtgcggccagcacggtctctacaccccctggtgatgggccaggcccc
tgtccccgggccgagcccatggacatggactga

DBGET integrated database retrieval system