KEGG   Sarcophilus harrisii (Tasmanian devil): 100915481Help
Entry
100915481         CDS       T02286                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04020  Calcium signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04114  Oocyte meiosis
shr04140  Autophagy - animal
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04310  Wnt signaling pathway
shr04340  Hedgehog signaling pathway
shr04371  Apelin signaling pathway
shr04530  Tight junction
shr04540  Gap junction
shr04611  Platelet activation
shr04713  Circadian entrainment
shr04714  Thermogenesis
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04727  GABAergic synapse
shr04728  Dopaminergic synapse
shr04740  Olfactory transduction
shr04742  Taste transduction
shr04750  Inflammatory mediator regulation of TRP channels
shr04910  Insulin signaling pathway
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04913  Ovarian steroidogenesis
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04922  Glucagon signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04924  Renin secretion
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing's syndrome
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04962  Vasopressin-regulated water reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04976  Bile secretion
shr05012  Parkinson's disease
shr05020  Prion diseases
shr05030  Cocaine addiction
shr05031  Amphetamine addiction
shr05032  Morphine addiction
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05166  HTLV-I infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05414  Dilated cardiomyopathy (DCM)
Module
shr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100915481 (PRKACA)
   04010 MAPK signaling pathway
    100915481 (PRKACA)
   04310 Wnt signaling pathway
    100915481 (PRKACA)
   04340 Hedgehog signaling pathway
    100915481 (PRKACA)
   04371 Apelin signaling pathway
    100915481 (PRKACA)
   04020 Calcium signaling pathway
    100915481 (PRKACA)
   04024 cAMP signaling pathway
    100915481 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100915481 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    100915481 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    100915481 (PRKACA)
   04540 Gap junction
    100915481 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100915481 (PRKACA)
   04062 Chemokine signaling pathway
    100915481 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    100915481 (PRKACA)
   04910 Insulin signaling pathway
    100915481 (PRKACA)
   04922 Glucagon signaling pathway
    100915481 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    100915481 (PRKACA)
   04912 GnRH signaling pathway
    100915481 (PRKACA)
   04913 Ovarian Steroidogenesis
    100915481 (PRKACA)
   04915 Estrogen signaling pathway
    100915481 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100915481 (PRKACA)
   04921 Oxytocin signaling pathway
    100915481 (PRKACA)
   04926 Relaxin signaling pathway
    100915481 (PRKACA)
   04918 Thyroid hormone synthesis
    100915481 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100915481 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100915481 (PRKACA)
   04916 Melanogenesis
    100915481 (PRKACA)
   04924 Renin secretion
    100915481 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100915481 (PRKACA)
   04927 Cortisol synthesis and secretion
    100915481 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100915481 (PRKACA)
   04270 Vascular smooth muscle contraction
    100915481 (PRKACA)
  Digestive system
   04970 Salivary secretion
    100915481 (PRKACA)
   04971 Gastric acid secretion
    100915481 (PRKACA)
   04976 Bile secretion
    100915481 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100915481 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100915481 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    100915481 (PRKACA)
   04727 GABAergic synapse
    100915481 (PRKACA)
   04725 Cholinergic synapse
    100915481 (PRKACA)
   04728 Dopaminergic synapse
    100915481 (PRKACA)
   04726 Serotonergic synapse
    100915481 (PRKACA)
   04720 Long-term potentiation
    100915481 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100915481 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    100915481 (PRKACA)
   04742 Taste transduction
    100915481 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100915481 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    100915481 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100915481 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    100915481 (PRKACA)
   04714 Thermogenesis
    100915481 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100915481 (PRKACA)
   05205 Proteoglycans in cancer
    100915481 (PRKACA)
   05203 Viral carcinogenesis
    100915481 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100915481 (PRKACA)
   05020 Prion diseases
    100915481 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    100915481 (PRKACA)
   05031 Amphetamine addiction
    100915481 (PRKACA)
   05032 Morphine addiction
    100915481 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100915481 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100915481 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    100915481 (PRKACA)
   05169 Epstein-Barr virus infection
    100915481 (PRKACA)
   05165 Human papillomavirus infection
    100915481 (PRKACA)
   05146 Amoebiasis
    100915481 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    100915481 (PRKACA)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100915481 (PRKACA)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  PKA family
   100915481 (PRKACA)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100915481 (PRKACA)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100915481 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100915481
NCBI-ProteinID: XP_003760707
Ensembl: ENSSHAG00000009246
Position
2
AA seq 352 aa AA seqDB search
MGNAATAKKGSELESVKEFLAKAKEEFLKKWESPPQQSTVQLDQFDRIKTLGTGSFGRVI
LVKHKESGNYFAMKVLDKQKVVKLKQIEHTMNEKRILQAINFPFLVRLEYSFKDNTNLYM
VMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQG
YIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPF
FADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFA
TTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEEELRISITEKCAKEFADF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcggccaccgccaagaagggcagcgagctggagagcgtgaaagagtttcta
gctaaagccaaagaagaattcctcaagaaatgggaaagtccacctcagcaaagtacagtc
cagctggatcaatttgacagaatcaagactctaggcactggttcctttggtcgagtgata
cttgtgaagcacaaagaatcggggaactactttgccatgaaagtgcttgacaaacagaag
gttgtgaagctgaaacaaattgagcatacaatgaatgagaagcgtatcctgcaggccatc
aacttcccattccttgtgcgactagaatattccttcaaggacaacacaaacctgtacatg
gtgatggagtacgtcccaggtggggaaatgttttcccacctacggcggatcggaaggttc
agtgagccccatgctcgcttttatgcagctcagattgtcctgacctttgaataccttcac
tcattggacctgatctaccgggacctgaagcctgagaatcttctcattgaccagcagggc
tatatccaggtgacagattttggttttgccaagcgtgtgaaaggccgaacctggactttg
tgtgggacgcccgaatacctggctcctgagatcatccttagcaaggggtataacaaggct
gtggattggtgggccctaggtgtcctgatctatgaaatggcagcaggctatcctcctttc
tttgctgaccagcccatccagatatatgaaaagattgtgtctgggaaggtgcgattccct
tctcacttcagctccgatttaaaggacctgcttcggaatctgctccaagtggacctcacc
aaacgctatgggaacctcaaaaatggtgtcaatgacatcaagaaccacaaatggttcgcc
accactgactggatcgccatctaccagaggaaggtggaagctccctttataccaaagtgc
aaaggcccaggtgacacaagtaattttgatgattatgaggaagaagagctccggatctcc
atcactgagaagtgcgccaaggaatttgccgacttctaa

DBGET integrated database retrieval system