KEGG   Sarcophilus harrisii (Tasmanian devil): 100915548Help
Entry
100915548         CDS       T02286                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  
Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
EGFR tyrosine kinase inhibitor resistance
Platinum drug resistance
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
NOD-like receptor signaling pathway
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100915548 (BCL2L1)
   04630 Jak-STAT signaling pathway
    100915548 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100915548 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100915548 (BCL2L1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100915548 (BCL2L1)
   04215 Apoptosis - multiple species
    100915548 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100915548 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100915548 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    100915548 (BCL2L1)
   05212 Pancreatic cancer
    100915548 (BCL2L1)
   05220 Chronic myeloid leukemia
    100915548 (BCL2L1)
   05222 Small cell lung cancer
    100915548 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100915548 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    100915548 (BCL2L1)
   05145 Toxoplasmosis
    100915548 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100915548 (BCL2L1)
   01524 Platinum drug resistance
    100915548 (BCL2L1)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100915548 (BCL2L1)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100915548 (BCL2L1)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100915548 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 227 aa AA seqDB search
MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVS
GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENG
GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacagtaaccgggagctggtggttgactttctttcttacaagctttcacagaag
ggatacaattggagtcagtttgaagatgagaacaggactgaggcctcagaagggacagag
atacctagtactgtgaatggcagcccctcttggcaccctgctgacagccgtgcagtgagt
ggggccacaggacacagcagcagcctggatgcccatgagacaattcctgtagctgctgtg
aagcaagctttgagggaggcaggagatgaatttgaactccggtaccggcgggcattcagt
gatctgacatcccagctccacatcactccagggacggcttatcagagttttgagcaggta
gtgaatgaactcttccgggatggggtgaactggggccgaattgtggcattcttctccttc
ggaggggcattgtgtgtggaaagcgtggataaagagatggaagtcttggtagcacgcatc
acctcctggatggccacttacttggatgagcacctagacccatggatccaagaaaatggc
ggttgggacaccttcgtggagctttatgggaatgatgcagcagcagagagccggaagggc
caggaacgcttcaacagatggctgctgactggcatgacagtggctggtgtagtcctgctg
gggtccctgttcagccggaagtga

DBGET integrated database retrieval system