KEGG   Sarcophilus harrisii (Tasmanian devil): 100915548Help
Entry
100915548         CDS       T02286                                 

Definition
uncharacterized LOC100915548
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100915548
   04630 Jak-STAT signaling pathway
    100915548
   04064 NF-kappa B signaling pathway
    100915548
   04151 PI3K-Akt signaling pathway
    100915548
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100915548
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100915548
   05202 Transcriptional misregulation in cancers
    100915548
   05212 Pancreatic cancer
    100915548
   05220 Chronic myeloid leukemia
    100915548
   05222 Small cell lung cancer
    100915548
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100915548
  Infectious diseases
   05166 HTLV-I infection
    100915548
   05145 Toxoplasmosis
    100915548
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100915548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 483 aa AA seqDB search
MSPPLYSWGSQVSAPPQGEGECVTGTAPNRRATRRPSCPAPCLDHLADWPSGGGATGRSV
GGTPLSPPPSSLCWGLGGAGREGRRLPGNVVGSGWAGPHLPGGRRCGAEGWGRSPGSPVV
PPRKKTWGEAGPARAGAKRPQTAEAPRPSLRLLCPEVLAAMMPGRRRGRAEGAPSPSRTP
LDLEDICGQQLHKTTNRTPTPATRPSGKAARQEPPRPLRRTSIFAQDFRRELSSRSQTQR
AGALDNELDQPIPDVKMSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPST
VNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTS
QLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARITSWM
ATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLF
SRK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccccccctctactcgtggggctcgcaggtgagcgcgccgccccagggggagggg
gagtgcgtgacgggcaccgcgcccaatcggagggcgacaaggaggccttcgtgtcccgcc
ccctgccttgaccacctcgctgattggccgtcggggggcggagccaccgggagatcggtg
ggcgggacgcccctttctccccctccctccagcctgtgctggggtctggggggcgccggg
agggaaggaaggcggttgcccggcaacgtggttggctcgggctgggccgggccgcacctc
cccggcgggcggcgctgtggagccgagggctggggaaggagtcctgggagtccggtggta
cccccgcgaaagaaaacctggggggaagcggggcccgcgcgggccggggccaagcgcccc
cagacagccgaagcccctcgaccctcgctccggctcctttgtcctgaagtgctggcagcc
atgatgcccggacgccgccgggggcgagcggaaggggccccgagcccatcccggacgccc
ctagatcttgaggacatttgcgggcaacaactgcacaaaacaacaaaccgaacaccaacc
ccagctacacgcccctcgggcaaggcggcccggcaggagcctccccgcccgcttcgccga
accagcatttttgcccaggatttcagaagagagctgtcaagcagatcccagactcagaga
gcaggtgctttggacaatgaactggatcagcccattcctgatgtaaaaatgtctcacagt
aaccgggagctggtggttgactttctttcttacaagctttcacagaagggatacaattgg
agtcagtttgaagatgagaacaggactgaggcctcagaagggacagagatacctagtact
gtgaatggcagcccctcttggcaccctgctgacagccgtgcagtgagtggggccacagga
cacagcagcagcctggatgcccatgagacaattcctgtagctgctgtgaagcaagctttg
agggaggcaggagatgaatttgaactccggtaccggcgggcattcagtgatctgacatcc
cagctccacatcactccagggacggcttatcagagttttgagcaggtagtgaatgaactc
ttccgggatggggtgaactggggccgaattgtggcattcttctccttcggaggggcattg
tgtgtggaaagcgtggataaagagatggaagtcttggtagcacgcatcacctcctggatg
gccacttacttggatgagcacctagacccatggatccaagaaaatggcggttgggacacc
ttcgtggagctttatgggaatgatgcagcagcagagagccggaagggccaggaacgcttc
aacagatggctgctgactggcatgacagtggctggtgtagtcctgctggggtccctgttc
agccggaagtga

DBGET integrated database retrieval system