KEGG   Sarcophilus harrisii (Tasmanian devil): 100915879Help
Entry
100915879         CDS       T02286                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100915879 (USP40)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100915879 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1249 aa AA seqDB search
MEAGPPEPPDLGGGSCWARESLWERTRGPEPGSGLCLDEGVGGTSDETEPGETDPAAGKK
ALFALDPEELGLLEDKDDPNAKVRIIPLQLQRLFAQLLLSDQQAASTTDLTDSFGWNNSE
EMRQHDVQELNRILFSALESSLVGTSGHDLINRLYHGTIVNHIMCKECENVSERQEDFLD
LTVAVKNLTGLEEALWSMYVEEEFFDAENLYHCGTCDKLVCATKSARLRKLPPFLTISLL
RFNFDFAKRERYKETGSYTFPLQIDLKPFCEQSELDDSEYLYDLFSVIIHKGGCYGGHYH
VYIKDVDQLGNWQVEPEAVAEATSLKDLPSIQEADNPLMVLKHILSQEENKLIPVDQLGQ
KLLASIDISWNKKYRKQHGSLLKFLQAHSDVFLVSSNPSKVCLRRDAGPAQSPPAELDQT
GPVAPSQGGDPEVCGAESAGEQQVEVSVEGPHWFDINDSQVEPIQEADIEKQFQGKESAY
MLFYRKTQLQRPPEAQSNPWYKVPNHLLREVHEANSELQKKRADYDSVVNNLDLHLHLGP
CYEFYNGALHPSSSRTEDCMLDLTIDKRKTLGDLRQAIFQLLEFWEGDLVLSVAKLVPAG
LHVCHAFEGDELTLHEIEMTDGEDIFVWNGMEVGGVRIPTGDDSIPILLTILQLTNNNVG
EKGQSFIERRQVFPSNAKVSTLFTVLAFPVGLVLVNITGSRVLELENWTVIPKENLEQTF
KDHGLQDGSSVWILNSNSCDQSLVMPGGRRMNSLSNFNWMQVKNLCQADSEEEQVKVSAT
IETTLLDIRIKAIKELGLQEELVHNSCLRLIDRNGQLLFPVPEHYTVAEAEMEMGSLLGL
CRGKAPTSSQLFLFFTVGSDFESGLMMEIIVESTISVRECLKGMLEKAGLQGDSWHLRKM
DWCFEAGEPLSEENASLSELMITSGDTLILSEGKLPPKGFLKVPVWWYRPSAPSGWQENP
QNQVNHITHQVEALRTIPEGGDLHGDIPIVVQPEIPFTFMGDVEISEEASVADLKTQAMM
LPSFLEFSFPSADFLRAWTMESKRPGRLLRNNQQQLKDYKVGGRTQICVEPLQKAENLGP
KDMLLRTQMGIPGERAYYPTVDFVWDIVNECTASSLRQAVAAQYCLPMDSIEIAKYFPDK
FEWMPISSWDQQVSKRKKKKKQENLQIAPYYLKDGDIIGVKNLLVDDNKDFSTPRDDIGK
ENQTKLFVGKRRRRQAVQLQSSDLEADPHVHEKAHRPEAGLSINVGVFR
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggcctccggagcccccggacttgggaggcggcagctgctgggccagagaa
agtctctgggaaaggacccgggggcctgagcctggctctgggctctgcttggatgagggc
gtcggaggaacttccgatgagacagagccgggagagacggacccagcggccggcaagaaa
gctttgtttgccctggatccagaagagcttggattgttagaggacaaggatgaccccaat
gcgaaggtgcgaatcatccctctgcagttacagcggctctttgctcagctgcttctctca
gaccagcaggcggcgtccaccacggacctcactgacagcttcggctggaacaacagcgag
gagatgaggcagcatgacgtgcaggagctgaaccggattctcttcagcgccctggagagc
tccctggtgggcacctccggccatgacctcatcaaccgcctctaccacggcaccatcgtg
aaccacatcatgtgcaaggagtgtgagaacgtcagcgagcggcaggaggacttcctggac
ttgaccgtggcggtcaaaaacctgaccggcctcgaggaagccctctggagcatgtatgtg
gaagaggagttcttcgatgcagaaaacctgtatcactgcggaacctgtgacaagcttgtt
tgtgcgaccaagtcagcccgcctgcgcaagctgccgcctttcctgaccatttcgctgctg
aggtttaactttgactttgccaagcgggagcgctacaaggagacgggctcctacacgttc
cctctgcagatagacctgaagcccttctgcgagcagagcgagctggatgactcggagtac
ctgtatgacctcttctccgtgatcatccacaaaggcggctgctatggagggcactaccac
gtgtacattaaagacgtcgaccagctaggaaactggcaggtggagcctgaagctgttgcc
gaggccacgagtttgaaagatcttccaagtatccaagaagcagacaacccgctgatggtc
ctcaagcacatcttatcccaggaggagaataagctgattcctgtggaccagctgggccag
aagctcttagcgagcatagacatatcctggaacaagaagtaccggaagcagcatggctcc
ctgctgaagtttctgcaggcccattcggatgtgtttctcgtcagctcgaaccccagcaag
gtctgtctcaggagggatgccggccctgctcagtcgccccccgctgagctggaccagacc
gggcccgtggccccttctcagggcggggaccccgaggtctgtggggccgagtctgccggg
gagcagcaggtggaggtgagcgtcgaaggccctcattggttcgacatcaacgactcccaa
gtggagcccatccaggaggcggacattgagaagcagtttcaggggaaggagagcgcctac
atgctgttttaccggaagacccagctgcagaggcccccggaagctcagtcgaacccgtgg
tacaaggttccaaatcacctgttgagggaggtgcacgaagccaacagtgagctgcagaag
aagagggcagactatgactctgtggtcaacaatctggacctgcatctgcacctgggccct
tgctatgagttttacaatggggccctgcacccctcttcctccaggacagaagattgcatg
ctggacttgaccatcgacaaaaggaaaacgttaggcgatctgcggcaggccatatttcag
ctcctggaattctgggaaggggatctggtgctcagcgttgccaagctcgtgcctgcggga
ctccatgtttgccacgcctttgaaggagatgaactgacattgcatgaaattgaaatgacc
gatggggaagacatctttgtgtggaatgggatggaggttggtggggtcaggattccaacc
ggcgatgactccattcccatccttttgactattcttcaactcacaaataacaatgtggga
gaaaaggggcagtcgtttatagaaagacgccaagtgtttccctcgaatgctaaagtgagc
accctattcacagtcttagcgttccctgttggcctcgtcctggtaaacattacaggctct
cgggttcttgagttagagaactggacagtcattcccaaggagaacctggaacagacattc
aaagaccatggccttcaagatggcagctccgtgtggatattaaactccaacagctgtgac
caaagcttggtgatgcccggaggcagacggatgaattctctgagcaacttcaattggatg
caggttaaaaatctgtgccaagcagattccgaggaggagcaagtgaaagtttctgcgaca
attgaaacaacgctgttggacatcagaatcaaggccatcaaggagctgggcctgcaggag
gagttggttcacaacagctgcttgaggctgatcgacaggaacgggcagcttctttttcca
gtgcccgagcattacaccgtggccgaggcagagatggagatgggcagtctgttgggactc
tgtcggggcaaagctccaacgtcctcacagctgttcctgtttttcaccgtgggctccgac
tttgagtcgggcctcatgatggagatcattgtggagtcgacaatctctgtgagagaatgt
ttgaaggggatgctggagaaagccggtctgcaaggtgactcatggcatttgcgaaaaatg
gattggtgctttgaagctggagagcctttaagtgaggaaaacgcttccctgagtgagctt
atgatcaccagtggagacactctgatcttgtctgaaggaaagctcccccccaagggcttt
ctaaaagtgcctgtctggtggtaccggccatcagctccctcgggctggcaggagaatccc
cagaaccaggtgaaccacatcactcaccaggtggaggctttgagaaccattcccgaagga
ggggatctgcatggagatattccgattgtggtccagccggagattccgtttactttcatg
ggggacgttgagatctccgaagaagcttctgtggcggatctcaagacccaggccatgatg
ctgccgtccttcctggagttcagttttccgtcggccgacttcctcagagcctggaccatg
gaaagtaagcgtccaggcaggcttttacgaaacaaccagcaacaactcaaggattacaaa
gtgggaggaaggactcagatctgtgtggagcccctccagaaggcagagaacttgggcccc
aaggacatgctgctgaggacccagatgggcatccccggggagagggcctactaccccacg
gtggactttgtctgggacattgtgaatgagtgcaccgcgtcatccctgcgccaggccgtg
gccgcccagtactgcctccccatggacagcatcgagatcgccaagtacttcccggacaag
tttgagtggatgcccatctccagctgggatcagcaagtttccaagaggaaaaagaagaag
aagcaggagaacttgcagatagccccttattacctgaaggatggagacattattggggta
aagaatctgctggtagacgacaacaaagacttcagcacgccgagagacgacattggcaaa
gagaatcagaccaagctctttgtgggaaagaggagaaggcgacaggctgtccagctgcag
agcagcgaccttgaggccgacccgcacgtgcacgagaaggctcaccgccccgaagctggg
ctctccatcaacgtgggcgttttcagatag

DBGET integrated database retrieval system