KEGG   Sarcophilus harrisii (Tasmanian devil): 100915907Help
Entry
100915907         CDS       T02286                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100915907
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100915907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 224 aa AA seqDB search
MTGSWDKTLKFWDTRSPSPMMTLQLPERCYCADVVYPMAAVATAERGLIVYQLENQPSEF
RRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNG
TNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFN
HNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactggaagctgggataaaactttaaagttttgggacacacggtcaccaagtcctatg
atgacattgcagcttcctgaaagatgttactgtgctgatgtggtctaccccatggcagct
gtagctactgctgagagaggattgatagtttatcaattagagaatcagccttctgaattc
aggagaatagaatctcctcttaaacatcagcatcgctgtgttgccatttttaaagacaaa
cagaataagcctactggttttgctctgggaagtattgaaggaagagttgctattcattat
attaatccaccaaatcctgccaaagataacttcacctttaaatgtcatcgttctaatgga
actaatacttcagctcctcaagatatctatgcagtaaatgggatagcatttcatcctgtt
catggaacccttgcaactgtaggatctgatggtagattcagtttttgggacaaagatgca
aggacaaaactaaaaacttcagaacaattagatcagccaatttccgcttgttgtttcaat
cacaatggaaacatatttgcatatgcttctagctatgattggtcaaagggacatgaattt
tataatccccaaaagaaaaattacatttttctacgtaatgcagcagaagagttaaagccc
agaaataagaagtaa

DBGET integrated database retrieval system