KEGG   Sarcophilus harrisii (Tasmanian devil): 100915907Help
Entry
100915907         CDS       T02286                                 

Gene name
RAE1
Definition
(RefSeq) mRNA export factor
  KO
K14298  mRNA export factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
shr05164  Influenza A
Module
shr_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100915907 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100915907 (RAE1)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100915907 (RAE1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100915907 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 100915907
NCBI-ProteinID: XP_003759251
Ensembl: ENSSHAG00000002438
Position
1
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTTGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSPSPMMTLQLPERCYCADVVY
PMAAVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcttatttggaacaacctcaggttttggaactactggaacaagcatgtttggtagc
acaacaacagataatcacaatcctatgaaggatattgaagttacatcttctcctgatgac
agtattggatgtctttcttttagcccacctaccttgccagggaactttcttattgcagga
tcctgggctaatgatgttcgatgttgggaagttcaagataatggacaaactattccaaaa
gcccagcaaatgcacacaggacccgtacttgatgtctgttggagcgatgatgggagtaaa
gtatttacggcatcttgtgataaaactgccaaaatgtgggacctcaacagcaaccaggct
atacagattgcacagcatgatgcccctgtgaaaactgtgcattggatcaaagcaccaaat
tatagctgtgtgatgactggaagctgggataaaactttaaagttttgggacacacggtca
ccaagtcctatgatgacattgcagcttcctgaaagatgttactgtgctgatgtggtctac
cccatggcagctgtagctactgctgagagaggattgatagtttatcaattagagaatcag
ccttctgaattcaggagaatagaatctcctcttaaacatcagcatcgctgtgttgccatt
tttaaagacaaacagaataagcctactggttttgctctgggaagtattgaaggaagagtt
gctattcattatattaatccaccaaatcctgccaaagataacttcacctttaaatgtcat
cgttctaatggaactaatacttcagctcctcaagatatctatgcagtaaatgggatagca
tttcatcctgttcatggaacccttgcaactgtaggatctgatggtagattcagtttttgg
gacaaagatgcaaggacaaaactaaaaacttcagaacaattagatcagccaatttccgct
tgttgtttcaatcacaatggaaacatatttgcatatgcttctagctatgattggtcaaag
ggacatgaattttataatccccaaaagaaaaattacatttttctacgtaatgcagcagaa
gagttaaagcccagaaataagaagtaa

DBGET integrated database retrieval system