KEGG   Sarcophilus harrisii (Tasmanian devil): 100916052Help
Entry
100916052         CDS       T02286                                 

Definition
(RefSeq) acrosin-like
  KO
K01317  acrosin [EC:3.4.21.10]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100916052
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100916052
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100916052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100916052
NCBI-ProteinID: XP_003772634
Ensembl: ENSSHAG00000002444
UniProt: G3VHV9
Position
5
AA seq 434 aa AA seqDB search
MAGTGMLWQLVLLFLWGTVGANADTSCSGLCGQRPLLTQIGHRVVGGINARPGAWPWIVS
VQIVYWNGRYRNHICGGSLIAPTWVLTAAHCFGKNESDLNKWRLVTGAWEIQHGWNYGPV
DPKVQERKPIKIIPHENYNRNFQENDIALVQLESPIRCGDVIRIACLPRPGEGPTKSEEK
CAIAGWGYTIEGGSPSRILQEALVSMLDIRICNGSRWYYGYIHRYNLCAGYQEGKIDTCQ
GDSGGPLMCKDKDSGIYVVVGITSWGTGCARAFRPGIYTSTWHFLDWIASKIGPGSVISD
LPPPTTTPPTTTTTIPPPVSTTVVTHRPWNWFPTSRPWEHKPWSYFFFKKTTTRGWATHY
KPWKGSSSDSWSPSFQPLAGPPPTRPSIYTALRPWISNPVMVKSQVVGPGQPVSLSFPKR
LKLLMESMKSSRST
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggggactggtatgctgtggcagctagtgctgctgttcctttgggggactgtgggg
gctaatgctgacacatcctgctcgggtctctgtggacagaggccattgctcacccaaatt
ggccatcgggtcgttgggggcataaatgcgcgcccaggagcatggccctggatagtcagt
gtgcagatcgtatattggaatggcaggtacaggaaccacatctgtgggggctccctcata
gctccgacctgggttctcactgctgcccactgcttcggtaaaaatgaaagtgaccttaac
aagtggcgacttgtgactggtgcgtgggagattcagcatggatggaattatggccctgtc
gaccccaaagtgcaggagcgaaagcccatcaagattataccacatgaaaattacaataga
aattttcaggaaaatgacattgcactagtccagctggaaagtccgatccggtgtggggat
gtgatccgtatcgcctgtctgcctcgacctggcgagggcccaaccaagtcggaggagaag
tgtgccatcgctggctggggctacacgatagaaggcggctccccatcacggatcctgcag
gaagccttggttagcatgctggatattaggatctgcaatggaagccgctggtactacggg
tacattcaccgatacaatctttgtgctggctaccaagaggggaagatcgacacttgccag
ggggacagtggggggccgctcatgtgcaaagacaaagacagcggcatctacgtggtggta
ggcatcacgagctgggggacaggctgcgcccgggcctttcggccaggcatctacacgtcc
acctggcactttctggactggatcgcttccaagatcgggcccggctcggtcatctccgac
ctacctcctccgaccacgaccccgcccaccaccaccacgaccatcccccctcccgtttcc
actactgtggtaactcatcggccctggaactggttccccactagcagaccctgggaacac
aagccctggtcctacttctttttcaagaagaccaccacccgaggctgggccacccattac
aagccctggaaggggagctcctccgacagttggtctccgagcttccagcccttagcaggc
cccccgcctactcgcccatccatatacacagctctccggccctggatctccaatccggtg
atggtcaagtcccaagttgtgggccctggtcagcccgtctctctctccttccccaagcgc
ttgaagttgctcatggaatccatgaagagcagcagatccacataa

DBGET integrated database retrieval system