KEGG   Sarcophilus harrisii (Tasmanian devil): 100916052Help
Entry
100916052         CDS       T02286                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100916052
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100916052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 434 aa AA seqDB search
MAGTGMLWQLVLLFLWGTVGANADTSCSGLCGQRPLLTQIGHRVVGGINARPGAWPWIVS
VQIVYWNGRYRNHICGGSLIAPTWVLTAAHCFGKNESDLNKWRLVTGAWEIQHGWNYGPV
DPKVQERKPIKIIPHENYNRNFQENDIALVQLESPIRCGDVIRIACLPRPGEGPTKSEEK
CAIAGWGYTIEGGSPSRILQEALVSMLDIRICNGSRWYYGYIHRYNLCAGYQEGKIDTCQ
GDSGGPLMCKDKDSGIYVVVGITSWGTGCARAFRPGIYTSTWHFLDWIASKIGPGSVISD
LPPPTTTPPTTTTTIPPPVSTTVVTHRPWNWFPTSRPWEHKPWSYFFFKKTTTRGWATHY
KPWKGSSSDSWSPSFQPLAGPPPTRPSIYTALRPWISNPVMVKSQVVGPGQPVSLSFPKR
LKLLMESMKSSRST
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggggactggtatgctgtggcagctagtgctgctgttcctttgggggactgtgggg
gctaatgctgacacatcctgctcgggtctctgtggacagaggccattgctcacccaaatt
ggccatcgggtcgttgggggcataaatgcgcgcccaggagcatggccctggatagtcagt
gtgcagatcgtatattggaatggcaggtacaggaaccacatctgtgggggctccctcata
gctccgacctgggttctcactgctgcccactgcttcggtaaaaatgaaagtgaccttaac
aagtggcgacttgtgactggtgcgtgggagattcagcatggatggaattatggccctgtc
gaccccaaagtgcaggagcgaaagcccatcaagattataccacatgaaaattacaataga
aattttcaggaaaatgacattgcactagtccagctggaaagtccgatccggtgtggggat
gtgatccgtatcgcctgtctgcctcgacctggcgagggcccaaccaagtcggaggagaag
tgtgccatcgctggctggggctacacgatagaaggcggctccccatcacggatcctgcag
gaagccttggttagcatgctggatattaggatctgcaatggaagccgctggtactacggg
tacattcaccgatacaatctttgtgctggctaccaagaggggaagatcgacacttgccag
ggggacagtggggggccgctcatgtgcaaagacaaagacagcggcatctacgtggtggta
ggcatcacgagctgggggacaggctgcgcccgggcctttcggccaggcatctacacgtcc
acctggcactttctggactggatcgcttccaagatcgggcccggctcggtcatctccgac
ctacctcctccgaccacgaccccgcccaccaccaccacgaccatcccccctcccgtttcc
actactgtggtaactcatcggccctggaactggttccccactagcagaccctgggaacac
aagccctggtcctacttctttttcaagaagaccaccacccgaggctgggccacccattac
aagccctggaaggggagctcctccgacagttggtctccgagcttccagcccttagcaggc
cccccgcctactcgcccatccatatacacagctctccggccctggatctccaatccggtg
atggtcaagtcccaagttgtgggccctggtcagcccgtctctctctccttccccaagcgc
ttgaagttgctcatggaatccatgaagagcagcagatccacataa

DBGET integrated database retrieval system