KEGG   Sarcophilus harrisii (Tasmanian devil): 100916150Help
Entry
100916150         CDS       T02286                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl releasing protein 2 (calcium and DAG-regulated)
  KO
K12361  
RAS guanyl-releasing protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100916150 (RASGRP2)
   04015 Rap1 signaling pathway
    100916150 (RASGRP2)
   04010 MAPK signaling pathway
    100916150 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100916150 (RASGRP2)
   04062 Chemokine signaling pathway
    100916150 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100916150 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 444 aa AA seqDB search
MPLSPRPFLLFVWRTRFIPLSAHLPAPLVCGPPGPCPPPSASCLTCAPCLADSAAAASPP
SPARGPQKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTVKLWEGLTELVTATGN
YSNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDAAHTRLNGAKMRQLFAILEELA
MVTSLRPPIQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPASSTPAPRPP
VLEEWTAAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLIAFG
DLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESSSLRPVACRHCKALILGIYKQ
GLKCRACGVSCHKQCKDRLAVECRRRAQSVSMEGPPAPSPPHTHLRAFSFSLPRPGRRGS
RPPAPEIQEEAVQAVEDGVFDIHL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtccccccgccccttcctcttgtttgtctggaggacgcgcttcatcccgttg
tctgctcatttacccgcgccccttgtctgtggtccgcccggcccttgtccccccccttcc
gcctcgtgtctcacttgtgctccttgccttgcggactccgctgctgcggcctctccccca
tctcctgcccggggcccacagaagctgctccagctgcagaacttcaacactctcatggcc
gtggtcgggggcttgagccacagctccatctcccggctcaaggagactcacagccacgtc
agcccagacaccgtcaagctctgggaaggcctgacggagctggtgacggccacgggcaac
tacagcaactaccgccggcggctggcggcctgcgtgggctttcgcttccccatcctgggc
gtgcacctcaaggacctggtggccctgcagctggcccttcccgactggctggacgccgct
cacacgcggctcaatggggccaagatgcggcagctcttcgccatcctggaggagctggcc
atggtgaccagccttcggccgcccatccaagccaacccggacctgctgagcctgctcacg
gtgtctctggaccagtaccagactgaagacgagctgtaccagctctccctgcagagagag
ccacgctccaagtcctcgccaacgagcccggcgagcagtactccggccccccgaccccca
gtcctggaggagtggaccgcggccgccaaacccaaactggaccaagccctggtggtggag
cacattgagaagatggtggagtccgtgttccggaactttgatgtggatggggacggtcac
atctcccaggaggagttccagatcatccgggggaatttcccttacctcatcgcctttggg
gacctggaccaaaaccaggacggctgcatcagccgggaggagatggtctcctacttcctg
cgctccagttctgtgctggggggccgcatgggctttgtgcacaatttccaggagagcagc
tccctgaggcccgtagcctgcaggcactgcaaggccctgatcctgggcatctacaaacag
ggactgaaatgccgagcctgtggagtgagctgccacaaacagtgcaaggatcggctcgcg
gtggagtgccggcgccgggcccagagcgtgagcatggaggggccgcccgcaccctcccct
ccccacactcacctccgagcgtttagcttttccttgcctcgccccggtaggcgagggtcc
cggccgccagctccggagatccaagaagaggccgtccaagctgtggaggacggagtgttc
gacatccacttgtag

DBGET integrated database retrieval system