KEGG   Sarcophilus harrisii (Tasmanian devil): 100916150Help
Entry
100916150         CDS       T02286                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04062  Chemokine signaling pathway
shr04611  Platelet activation
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100916150 (RASGRP2)
   04015 Rap1 signaling pathway
    100916150 (RASGRP2)
   04010 MAPK signaling pathway
    100916150 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100916150 (RASGRP2)
   04062 Chemokine signaling pathway
    100916150 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100916150 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_5 EF-hand_7 RasGEF_N EF-hand_8
Motif
Other DBs
NCBI-GeneID: 100916150
NCBI-ProteinID: XP_023362312
Ensembl: ENSSHAG00000007269
Position
6
AA seq 609 aa AA seqDB search
MSGTLDLEKGCTVEELLQGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSLKENSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKSLLDRQGNRRHSSLID
IESVPTYKWKRQVTQRNPVSQKKRKMSLLFDHLEPLELAEHLTYLEYRSFRKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMVLSKPTAPQRAQVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTVKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDAAHTRLNGAKMRQLFAILEELAMVTSLRPPIQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPASSTPAPRPPVLEEWTAAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLIAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESSSLRPVACRHCKALILGIYKQGLKCRACGVSCHKQC
KDRLAVECRRRAQSVSMEGPPAPSPPHTHLRAFSFSLPRPGRRGSRPPAPEIQEEAVQAV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacgctggacctcgagaagggctgcaccgtggaggagctgctgcagggctgc
atcgaggccttcgatgactccgggaaggtgcgagacccgcagctggtgcggatgttcctg
atgatgcacccgtggtacatcccctcctcccagctggctgccaagctgctgcacatctac
cagcagtccctgaaggagaactccaactcgctgcaggtgaagacctgtcacctggtccgg
tactggatctctgccttccccgccgagtttgacttgaacccggagctggcagaacagatc
aaggagctgaagtctctgctggaccgccaggggaaccgccggcacagcagcctcatcgac
atcgagagtgtccccacctacaagtggaagcgccaggtcacccagcggaaccccgtgagc
cagaagaagcgcaagatgtccctactgtttgaccacctggagccactggagctggccgag
catctcacctacctggagtatcgctccttccgcaagatcttgttccaggactaccacagc
ttcgtgacccacgggtgtacggtggacaaccccgtcctggagcgcttcatctccctcttc
aacagcgtctcccagtgggtgcagctcatggtgctgagcaagcccacggccccacagcgg
gcccaggtcatcacccacttcgtccacgtggccgagaagctgctccagctgcagaacttc
aacactctcatggccgtggtcgggggcttgagccacagctccatctcccggctcaaggag
actcacagccacgtcagcccagacaccgtcaagctctgggaaggcctgacggagctggtg
acggccacgggcaactacagcaactaccgccggcggctggcggcctgcgtgggctttcgc
ttccccatcctgggcgtgcacctcaaggacctggtggccctgcagctggcccttcccgac
tggctggacgccgctcacacgcggctcaatggggccaagatgcggcagctcttcgccatc
ctggaggagctggccatggtgaccagccttcggccgcccatccaagccaacccggacctg
ctgagcctgctcacggtgtctctggaccagtaccagactgaagacgagctgtaccagctc
tccctgcagagagagccacgctccaagtcctcgccaacgagcccggcgagcagtactccg
gccccccgacccccagtcctggaggagtggaccgcggccgccaaacccaaactggaccaa
gccctggtggtggagcacattgagaagatggtggagtccgtgttccggaactttgatgtg
gatggggacggtcacatctcccaggaggagttccagatcatccgggggaatttcccttac
ctcatcgcctttggggacctggaccaaaaccaggacggctgcatcagccgggaggagatg
gtctcctacttcctgcgctccagttctgtgctggggggccgcatgggctttgtgcacaat
ttccaggagagcagctccctgaggcccgtagcctgcaggcactgcaaggccctgatcctg
ggcatctacaaacagggactgaaatgccgagcctgtggagtgagctgccacaaacagtgc
aaggatcggctcgcggtggagtgccggcgccgggcccagagcgtgagcatggaggggccg
cccgcaccctcccctccccacactcacctccgagcgtttagcttttccttgcctcgcccc
ggtaggcgagggtcccggccgccagctccggagatccaagaagaggccgtccaagctgtg
gaggacggagtgttcgacatccacttgtag

DBGET integrated database retrieval system