KEGG   Sarcophilus harrisii (Tasmanian devil): 100916170Help
Entry
100916170         CDS       T02286                                 

Definition
histone H2B subacrosomal variant-like
Orthology
K11252  
histone H2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100916170
  Immune diseases
   05322 Systemic lupus erythematosus
    100916170
  Substance dependence
   05034 Alcoholism
    100916170
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100916170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 127 aa AA seqDB search
MAKAVKSNESEKSSSTCQEKKRKPSQKNLLNRNYSLYTHRVLREVVPNQGLSSKTADVMN
RMINNILERIAEEACNLLCYKRHLTLSHQDLQMAVYRLLPNELAKHAVAFGTRAVTSYND
SKSPINL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcagtgaagtccaatgaaagtgaaaaatctagtagcacatgccaagagaaa
aagaggaaaccatcccagaaaaatctccttaacagaaattacagcctctacactcataga
gtgctgagagaagtggtccccaaccaaggtctgtcatccaaaaccgctgacgtcatgaac
cgcatgatcaataacatccttgagcgtattgccgaagaggcctgtaacctcttgtgttac
aaaagacatttaacccttagccaccaagatctccagatggcagtttacaggctactgccc
aatgagctggccaagcatgctgtggcttttggtacaagagctgttacaagttacaatgac
tccaagtctcctatcaacctgtga

DBGET integrated database retrieval system