KEGG   Sarcophilus harrisii (Tasmanian devil): 100916170Help
Entry
100916170         CDS       T02286                                 

Definition
histone H2B subacrosomal variant-like
Orthology
K11252  
histone H2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:shr05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:shr05322]
Human Diseases; Substance dependence; Alcoholism [PATH:shr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 127 aa AA seqDB search
MAKAVKSNESEKSSSTCQEKKRKPSQKNLLNRNYSLYTHRVLREVVPNQGLSSKTADVMN
RMINNILERIAEEACNLLCYKRHLTLSHQDLQMAVYRLLPNELAKHAVAFGTRAVTSYND
SKSPINL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcagtgaagtccaatgaaagtgaaaaatctagtagcacatgccaagagaaa
aagaggaaaccatcccagaaaaatctccttaacagaaattacagcctctacactcataga
gtgctgagagaagtggtccccaaccaaggtctgtcatccaaaaccgctgacgtcatgaac
cgcatgatcaataacatccttgagcgtattgccgaagaggcctgtaacctcttgtgttac
aaaagacatttaacccttagccaccaagatctccagatggcagtttacaggctactgccc
aatgagctggccaagcatgctgtggcttttggtacaagagctgttacaagttacaatgac
tccaagtctcctatcaacctgtga

DBGET integrated database retrieval system