KEGG   Sarcophilus harrisii (Tasmanian devil): 100916428Help
Entry
100916428         CDS       T02286                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 434 aa AA seqDB search
MDQPLTVNSLKKLAAGPDHTDTSLSPEERVRALSKLGCNITINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPTHRDYQQCAIPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNIEYQECLRSKNKYKADVLRKLEHQRLIEAEKQRIAQMRRQQLETEQFNFF
EDQLRKQELARDQLRSQEAPVLSEQPYGNALPCFSPHQNSHSLFSEQAPKNDVPTYAGQS
PPVNRALKPAATLSAVQNLVVEGLRCVLMPKDLCHRFLLLAESNTVRGIETCGILCGKLT
HNEFTITHVIVPKQSAGPDYCDVANVEELFSIQDQHSLLTLGWIHTHPTQTAFLSSVDLH
THCSYQLMLPEAIAIVCSPRHNETGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFSPCKH
VVGQDISITVLDLR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcctctgacggtgaattctctgaaaaagttagccgccgggccggaccacacg
gacacatccctgagtccggaggaacgtgtccgggccctgagcaagctgggatgcaacatc
accatcaacgaagacatcaccccgcgccgctacttccgatctggggtggagatggagcga
atggcgtccgtgtacctggaggagggaaacttggaaaatgcctttgtcctctataataag
tttataaccctgtttgtagaaaagctgcccactcaccgcgactaccagcagtgcgcaatc
cccgagaaacaggacatcatgaagaaactgaaggagattgcctttccaaggacagatgaa
ttgaaaaaggatcttttaaagaaatacaacatagaataccaagaatgcttacggagcaaa
aacaaatacaaagcagatgtgctcaggaagctggagcaccagcggttgatagaggcggag
aagcagcggattgcgcagatgcggcggcagcagctggagaccgagcagttcaacttcttt
gaggatcagctccggaagcaggagctggcccgagaccagctgcgcagccaggaggccccg
gtgctgtccgagcagccctacggcaatgccctgccttgcttcagcccccaccagaacagt
cactccctcttttccgagcaagcccctaaaaacgatgtgccaacatatgctggccagtcg
ccaccggtgaacagggcattgaagccggccgccacgctgagcgctgtccagaacctggtg
gtcgagggcctgcgctgtgtcctgatgcccaaggatctttgtcaccggttccttctcttg
gctgagtcaaacacagtgaggggcatagaaacctgtggaattctctgtggaaaactgacg
cacaacgagtttacaatcacccacgtcatcgtgcccaagcagtcggccggcccggactac
tgcgacgtggccaatgtggaggagctcttcagcattcaggaccagcacagcctcctcacc
ctgggatggatccatacgcaccccacgcagacggccttcctgtccagcgtggacctgcac
acgcactgctcctaccagctcatgctgccagaagccatcgccatcgtctgctcgcccaga
cataacgagacgggcatcttcagactcaccaacgccgggatgctggaggtgtcggcctgc
aagaagaagggcttccatccccacaccaaggaccccaggctgttcagtccgtgcaagcac
gtggtgggccaggacataagcatcacggtgctggacctgaggtga

DBGET integrated database retrieval system