KEGG   Sarcophilus harrisii (Tasmanian devil): 100916428Help
Entry
100916428         CDS       T02286                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100916428 (STAMBPL1)
Peptidases [BR:shr01002]
 Metallo Peptidases
  Family M67
   100916428 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 434 aa AA seqDB search
MDQPLTVNSLKKLAAGPDHTDTSLSPEERVRALSKLGCNITINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPTHRDYQQCAIPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNIEYQECLRSKNKYKADVLRKLEHQRLIEAEKQRIAQMRRQQLETEQFNFF
EDQLRKQELARDQLRSQEAPVLSEQPYGNALPCFSPHQNSHSLFSEQAPKNDVPTYAGQS
PPVNRALKPAATLSAVQNLVVEGLRCVLMPKDLCHRFLLLAESNTVRGIETCGILCGKLT
HNEFTITHVIVPKQSAGPDYCDVANVEELFSIQDQHSLLTLGWIHTHPTQTAFLSSVDLH
THCSYQLMLPEAIAIVCSPRHNETGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFSPCKH
VVGQDISITVLDLR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcctctgacggtgaattctctgaaaaagttagccgccgggccggaccacacg
gacacatccctgagtccggaggaacgtgtccgggccctgagcaagctgggatgcaacatc
accatcaacgaagacatcaccccgcgccgctacttccgatctggggtggagatggagcga
atggcgtccgtgtacctggaggagggaaacttggaaaatgcctttgtcctctataataag
tttataaccctgtttgtagaaaagctgcccactcaccgcgactaccagcagtgcgcaatc
cccgagaaacaggacatcatgaagaaactgaaggagattgcctttccaaggacagatgaa
ttgaaaaaggatcttttaaagaaatacaacatagaataccaagaatgcttacggagcaaa
aacaaatacaaagcagatgtgctcaggaagctggagcaccagcggttgatagaggcggag
aagcagcggattgcgcagatgcggcggcagcagctggagaccgagcagttcaacttcttt
gaggatcagctccggaagcaggagctggcccgagaccagctgcgcagccaggaggccccg
gtgctgtccgagcagccctacggcaatgccctgccttgcttcagcccccaccagaacagt
cactccctcttttccgagcaagcccctaaaaacgatgtgccaacatatgctggccagtcg
ccaccggtgaacagggcattgaagccggccgccacgctgagcgctgtccagaacctggtg
gtcgagggcctgcgctgtgtcctgatgcccaaggatctttgtcaccggttccttctcttg
gctgagtcaaacacagtgaggggcatagaaacctgtggaattctctgtggaaaactgacg
cacaacgagtttacaatcacccacgtcatcgtgcccaagcagtcggccggcccggactac
tgcgacgtggccaatgtggaggagctcttcagcattcaggaccagcacagcctcctcacc
ctgggatggatccatacgcaccccacgcagacggccttcctgtccagcgtggacctgcac
acgcactgctcctaccagctcatgctgccagaagccatcgccatcgtctgctcgcccaga
cataacgagacgggcatcttcagactcaccaacgccgggatgctggaggtgtcggcctgc
aagaagaagggcttccatccccacaccaaggaccccaggctgttcagtccgtgcaagcac
gtggtgggccaggacataagcatcacggtgctggacctgaggtga

DBGET integrated database retrieval system