KEGG   Sarcophilus harrisii (Tasmanian devil): 100916434Help
Entry
100916434         CDS       T02286                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100916434 (RASGRF2)
   04010 MAPK signaling pathway
    100916434 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1240 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWPEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERAPAPPKAASGAVGGKDSLDKQYYFTVLFGHEGQKPLELRCEEEHE
GKEWMDAIHQASYSDILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQGNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFNMVEAESEYVHQLYVLVNCFLRPLRMAASSKKPPITHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASEDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHRDDKDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLEKLSDIYKRPFTSIPVRSLELFFATSQNNRSEHLADGKSPH
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLSASSTTSSPTSTYSPATSPP
PHTGKVPLDLSRGPSSPEQSPGSLEENLNNPRMDLCNKLRRNIRRAVLETVSGDRTVSES
TPAVDIAELSPCRSPSTPRHLRYRPSGGQAADNTHCSVSPASAFAIATAAAGHGSPPGFN
NSERTCDKEFIIRRTATNRVLNVLRHWVSKHSQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDTHLKMEDIIQMIDCPKAECFETLSAMELAEQITLLDHIVF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANSIEKWV
AVADICRCMHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKIVSSEGRFKN
LRETLKNNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQ
TSYRIDHQPKVTQYLLDKTLIIDEDTLYELSLKIEPRLPA
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccttcctggcccgc
aaggagggtacgaagcgtggcttcttgagcaagaaggcggccgaggcgagccgctggccc
gagaagtggttcgctctctaccaaaatgtgctcttctacttcgagggagagcagagcggc
cggcccgccggcatgtacctgctggagggctgcagctgcgagcgggcgcccgccccgccc
aaggcggcgtctggggccgtgggtggcaaggactctttggataagcagtattacttcact
gttctctttggtcatgaaggtcaaaagccactagagctccgatgtgaagaggaacatgag
ggtaaggagtggatggatgccattcatcaagccagttattcagacattctgattgagaga
gaagtgttaatgcagaagtacatccatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcagcttgaggatcaagacactgaaattgaaaggcttaaatca
gagattattgctcttaataaaaccaaggaacgaatgcgaccatatcagggcaaccaggaa
gatgaagatccggacatcaaaaagattaaaaaggttcaaagctttatgcgaggatggtta
tgtagaagaaaatggaaaactattgttcaggattatatttgttctccccatgctgaaagt
atgagaaagagaaaccagattgttttcaacatggtagaggctgagtcagaatatgtacat
cagttgtatgttcttgttaactgtttccttcgccctttaagaatggctgcgagctcaaaa
aaacctccaattacccatgatgatgtcagcagtattttcctcaatagtgaaacaatcatg
ttcctccatgaaatatttcatcaaggattaaaggcaaggattgctaattggcctacttta
attttagctgatctatttgatattctactaccgatgcttaatatttatcaagaatttgtt
cgcaatcatcagtacagtcttcaagtgctagccaattgtaagcaaaacagagattttgac
aaactcttgaaacagtatgaagctaaccctgcctgtgaggggagaatgctggaaactttt
ctgacctatcctatgtttcagataccccggtatattataacactccatgaacttcttgct
catactcctcatgaacatgtggaaaggaagagtctggaatttgcaaaatcaaaactagaa
gaactctcaaggattatgcatgatgaagtgagtgataccgagaacatccggaaaaacctt
gccatagaaagaatgatagtggaaggctgtgatatattgttagacaccagccagactttt
attcgacaaggttctctcattcaagtcccttcagttgagagggggaaacttagtaaagtt
cgcctgggctcattgtctttgaaaaaagaaggagaaagacaatgcttcttatttacaaaa
cactttttaatttgtacaagaagctcaggaggaaaactgcacctgctcaagacaggcggt
gttctctctctcatagaatgcaccttgattgaggagcctgatgcaagtgaagatgattca
aaaggttctgggcaagtgtttggacatttggattttaagattgtggtggaacccccagat
tctgctcctttcacagttgtcttgttagcgccttctcgccaagaaaaagctgcctggaca
agtgatataagtcagtgtgttgacaacattcgctgcaatggcttaatgacaatagtattt
gaagaaaattccaaagtgacggtaccacatatgattaagtctgatgcccgtcttcacagg
gacgacaaagatatctgctttagcaaaacgttaaactcctgcaaagtgccccagattcgc
tatgccagtgtggagagacttctggagaggttgacagacttgcgttttctcagtattgac
tttctcaacacttttctgcatacttaccgtatcttcaccacagcagccgttgtcctggag
aagctgtcagacatatacaagagacctttcacatccatccctgtcaggtctttggaattg
ttttttgctaccagtcagaacaatcggagtgaacacttagcagatggaaagtcaccacat
ctttgtcgaaaattttcttctccacccccattggctgtgtccagaacttcttcccctgtc
agagccagaaagctgtcgttgacttcccccctgaactcaaaaattggagctctcgaccta
tctgcttcttccacaaccagcagtccaacctcaacttatagccctgctacatccccacca
ccccacactggtaaagtaccattggatcttagcagaggcccttcttctccagaacaaagc
cctggatctctagaagagaatttaaataacccccgcatggatctgtgtaacaagctaaga
cgaaatattcgaagagcagttctagaaacagtgtctggggatcgaacagtatctgaaagt
actccagccgtggacatagctgaactttcaccatgccgatcaccttcgactcctcgacat
ttaagataccgtccatctggaggacaggcagctgataatacccactgctctgtttcccct
gcctctgcttttgctattgcaacagctgctgcgggacatgggagtccaccaggatttaac
aacagtgagcgaacctgcgataaagagttcataatacgcagaacagccaccaatcgagta
ctgaatgttctccgtcactgggtctcaaagcactcacaggattttgaactcaacaatgag
ctaaagatgaatgtcctaaatttgctggaggaagtcttgagagacccagaccttctaccc
caagaaaggaaagccacagccaatatactgagggccctctctcaagatgatcaagatgat
actcacctcaaaatggaggatataatccaaatgattgactgtcctaaagcagaatgtttt
gaaaccctgtcagccatggaacttgctgaacagatcaccctgttagatcacatagtgttc
aggagcatcccctatgaagaatttcttgggcagggttggatgaaattggataaaaatgaa
agaacaccctacattatgaaaaccagccagcactttaatgatatgagtaaccttgtggcc
tcccagataatgaattatgctgatgtcagctctcgggctaattccattgagaaatgggtt
gctgttgcagatatctgtcggtgcatgcacaactacaatggagtattggagatcacctca
gccttaaatagaagtgcaatctacaggctgaagaaaacttgggccaaagtttcaaaacag
acaaaagctcttatggacaaacttcagaagattgtatcttcagaaggaagatttaaaaat
ctcagagaaacactcaaaaataattgtaacccgcctgcagtcccttatcttggaatgtat
ctaactgatctggcattcattgaagaaggaacaccaaactttactgaggaaggccttgtc
aatttttcaaaaatgagaatgatctcacacattatcagggagatacgtcaattccagcag
acttcctacaggatagatcaccagccaaaggtcactcagtacttgctggacaaaactctc
atcatagatgaggatacactatatgagctgtcactaaagattgaacctcgacttcctgct
tga

DBGET integrated database retrieval system