KEGG   Sarcophilus harrisii (Tasmanian devil): 100916574Help
Entry
100916574         CDS       T02286                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100916574
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100916574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 658 aa AA seqDB search
MGRRNSEHTRKASVETTKDHKAKSPKNKKDFQNIGYTSKVLPVSITKGGYNYEEGLRNPR
HHRYEVPIIYHQWEGRGGESNVRQLQGSPGLGAGAPRTGVGTGTQSPLTLPPLRSNTTAS
AVAHAIAGSKHVMNDHLVLGSHAQLQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPLVQ
ERQLDSVHRRQGSSNSLKSVEGTGKVKAASMTPEQAMKQYVLKLTAFEHHEIFSYPEIYF
LGPNAKKRQGTTGGPNNGGYDDDQGSYVQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHK
VHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRNHICMTFEL
LSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSG
IKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLP
GEDEGDQLACMIELLGMPAPKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSIILNGGRSR
RGKLRGPPESREWGTALKGCDDPLFLDFLKQCLEWDPAIRLTPGQALRHPWLRRRLPKPP
TGEKTAAKRITESAGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaagaaattcagaacacacccgtaaagcttctgtggagacaacaaaagaccat
aaggctaaaagccccaagaataagaaggacttccagaatattggctatacttctaaagtc
ctccctgtatccatcaccaaggggggctacaattatgaagaaggactccgtaatccccgc
catcatcgttatgaagtaccaatcatctatcaccaatgggaaggcagaggaggggaaagc
aacgtccgtcagctgcaaggttcgccaggactcggagctggggctccccggaccggagtg
ggaactggcacacagtcccccctcaccctgccgcctctcaggtccaacactacggcgtct
gccgttgcccatgcgattgctggtagcaagcacgttatgaatgatcacctggtccttggc
agccacgcacaactccaggtacagcagctttttgaagataatagtaataagaggacagtt
cttactacacaaccaaacgggcttacaacagttggtaaaaccggattgccactagtacaa
gaaagacaattggacagcgttcatagacggcaagggagctccaactctttgaagtctgta
gaaggaactgggaaagtaaaagccgcctctatgacaccggaacaggcaatgaagcaatat
gtgctaaagctaacagccttcgaacaccatgagatttttagttaccctgaaatatacttt
ttgggtccaaatgcaaagaaacgccaaggcacgacaggcgggccaaacaacggtggctac
gacgatgaccagggctcttacgtgcaagtgcctcacgatcacattgcttataggtacgaa
gtcctaaaggtcatagggaaagggagctttggacaagtggtgaaggcctatgaccacaaa
gtgcatcaacacgtggccctcaagatggtgaggaacgagaagcgtttccaccggcaggct
gcggaggaaatccggatcctggagcacctgcggaaacaggacaaggataacaacatgaac
gtcatccacatgctggagaatttcactttccgcaatcacatatgcatgacctttgagtta
ctgagtatgaacctctatgagctgatcaagaaaaacaaatttcagggcttcagcttgccc
ttggttcgaaaatttgcccattcaattttgcagtgcttagatgctttacacaaaaataga
atcattcactgtgaccttaaacccgagaacatcttattaaaacaacagggtaggagtggt
attaaggtgattgattttggctccagttgttacgaacatcagcgtgtctacacgtacatt
cagtcgcgtttttatcgggcaccggaggtgattcttggtgcccggtatgggatgcctatt
gatatgtggagcttgggctgtattctagcagagctcctgacaggttaccctctcttgcct
ggggaagatgaaggggaccagttggcttgtatgattgaactcttgggcatgccagccccc
aaacttctagacgcatccaaacgagccaaaaattttgtgagctctaagggttatccccgg
tactgcactgttacaactctgtccgacggctccatcattctaaatggtggccgctcccga
agggggaaactgaggggcccgccggagagtagagagtggggcactgcacttaaggggtgt
gatgatccacttttccttgatttcttgaaacagtgtttggaatgggatcctgccatacgc
ttgacccccggccaggcgttgagacacccctggctccggaggcgcctgccaaagcctcca
actggggagaagacagcagcaaaacggataacggaaagcgctggtgctataacgtctatt
tccaagttacctccaccttcaagctcagcatcaaaactgaggactaatttggcacaaatg
acagatgccaatgggaatattcagcagaggacagtgttgccaaaacttgttagctga

DBGET integrated database retrieval system