KEGG   Sarcophilus harrisii (Tasmanian devil): 100916604Help
Entry
100916604         CDS       T02286                                 

Gene name
EGR3
Definition
(RefSeq) early growth response 3
  KO
K12497  
early growth response protein 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100916604 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100916604 (EGR3)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100916604 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 350 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSSLNLFSGSSDAVAHYNQMATENVMDIGLA
NEKPNQELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPQGEVEPMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAKP
GLDSNLFPMIPDYNLYHHPNEMGSVTDHKPFQSMDPIRVNPPPITPLETIKAFKDKQIHP
GFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACLSEESQSRELELGVCPRGGMRWAC
FRRRETFILREMPRMPPPQGLLWPLGPLTSSLHGPQGAYSHLPGEGGGHD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagctctctcaacctcttctccggcagcagc
gacgcggtggctcattacaaccagatggctacagagaatgtgatggacatcggtctggcg
aacgagaagcccaaccaggaactctcttactccggctccttccagcccgctccgggcaac
aagacggtgacctacttggggaagttcgccttcgattccccttccaactggtgtcaggac
aacatcatcagcctcatgagcgccggcatcctaggggtgcccccggcctccggggcgctc
agtacacagacctctaccgccagcatggtgcagccgcagggcgaggtggaacccatgtac
ccggcgttgcccccttactccaactgcagcgacctctattctgagcccgtgtcttttcat
gaccctcagggcaaccccgggctcgcttattccccccaggattaccagtcggccaagccc
ggtttggacagtaaccttttccccatgatccccgactacaacctgtaccaccaccccaat
gagatgggatccgtcacggaccacaagccgttccagagtatggatcccatccgggtcaat
ccgccccccatcacccctctggagaccatcaaggctttcaaggacaaacagatccaccct
ggcttcggcagcttgccccagccgccgctcactctcaagcccatccggccccgcaagtac
cccaatcgacccagcaagaccccgctccacgaacgaccccacgcgtgcctctcggaggag
agccagagccgagagctggaattgggggtctgcccgcggggcgggatgaggtgggcttgc
ttccgtcgacgagaaaccttcattcttagagaaatgcctcggatgccgccgcctcagggt
ctcctttggcccctgggtcctctaacctcttccctccatggccctcagggcgcttactct
cacctgcctggagaaggaggcggccatgactga

DBGET integrated database retrieval system