KEGG   Sarcophilus harrisii (Tasmanian devil): 100916653Help
Entry
100916653         CDS       T02286                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100916653 (MRPS18B)
Ribosome [BR:shr03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100916653 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 253 aa AA seqDB search
MASSLLTLLLRRRLGLTPVRGVYWVQITHQALCTKVSPEEEGSIPVSPYQNAPWEYLETE
EYLTRYGSRPVWADYQRNHKGGIPPQRTRKTCIRGNKVAGNPCPICRDQKLHVDFRNVKL
LEQFICAQTGVIFHAPYTGICMKQHKKVTEAILKARDHGFLSYHIPLAQPRDTDFSNSHG
AVGCTPKAPALAAGTSWYPWYNWQQPPERELLRIRRLYQGHLKEENEPLLEMMPMSPSQI
NILPEGEESKSIH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctctctcctaactctgctgcttaggcggcgcttgggtctcacacctgtccga
ggtgtctactgggtgcagattactcaccaggcattatgcaccaaagtttcccctgaggaa
gaaggttccattcctgtctccccctatcagaatgctccgtgggaatatctggagacagaa
gaatacctgactcgatatggctcccgtccagtctgggctgactatcaaagaaaccataaa
ggtggcatcccaccacagcgaactcgtaaaacatgcattcgagggaacaaagttgctgga
aatccttgccccatctgccgggatcagaagctccatgtggactttagaaatgtgaagctc
ttggaacagtttatctgtgctcaaacaggtgtcatcttccatgccccatacacaggtatc
tgtatgaaacagcataagaaggtgacagaggccatcctgaaggctagagaccatggtttc
ctcagttatcacatccccctggcacagccacgggatactgatttcagcaattctcatgga
gctgttggctgtaccccaaaggctcctgccttagctgcaggtacctcctggtatccatgg
tacaattggcagcagccacctgagagagagctgttacgaattcgacgtctatatcaaggc
caccttaaggaagagaatgaaccccttctggaaatgatgcccatgagtccatctcaaatt
aatattctcccagagggagaggaatccaagagtatccactaa

DBGET integrated database retrieval system