KEGG   Sarcophilus harrisii (Tasmanian devil): 100916816Help
Entry
100916816         CDS       T02286                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:shr00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:shr04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:shr04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:shr04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 817 aa AA seqDB search
MPCSLWKRRNPRDPKSSFRILVSPGGSPHGAGLRALKKMDLNEDEDVLAMLKGSQFCKIR
SLKWQKVRFYRLQEDCMTVWFQRRFRHPKSHHIFSLQNIEAVRQGHQSEGLRRYGGSFPS
GCCLTITFKGRRKNLDLAALTEEEAQRWVRGLAKLRARLDAMSQREKLDHWIHGYLHQAD
SDHDSKMSFKEIKNLLQMVNVTMDDMYAQQLFKECDSSRNARLEGAEIEEFLRRLLKRPE
LEQIFYRYSGEDRVLSAAELLEFLRDQGDEGATMAHAQHLIHTYELNEKAKQHDLMMLDG
FMMYLLSPEGAILDPTHQGVYQDMSQPLSHYFISSSHNTYLTQSQIGGASSTEAYIRAFA
QGCRCVELDCWDGPDGEPVIYHGHTLTSKILFRDVIHVVRDHAFSQSPYPVILSLENHCG
MEQQSTMAHYLRTILGNMLVTETLDGKIPKELPSPEQLKGKILVKAKKQNVHQKKEVQSD
LPDEDKEKEESEEEEEETEAGNQNKETKRSPQISSELSDLVIYCCALKVEKLPRINPQPC
WVPSFTELKARKFIKEDGNSFVRHNTYHLCRVYPWGFKMTSANYNPQEMWNGGCQLVALN
FQTPGYEMDLNNGRFLVNGKCGYVLKPDFLRQKDTTFDPEHPGPPQTTLIIKVLTAQQLP
KLNREKPNSIVDPLVWVEIYGVPRDCARKNTNYVLNNGFNPYWGETLKFTLRAPELALVR
FVVKDYDAISSDDFVGQFTLPLCSLKQGYRHIHLYSEDGASLSPATLFVHIQIKSGSTGS
LSLAVTLQSYTWDSVWATGDSRFHENQTNSGGFHVLL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgctccttgtggaagagacggaacccccgggacccgaagtcctcgttccggatc
ctggtgtcgccgggcgggagcccgcacggggccgggctgcgcgcgctgaagaagatggac
ctgaatgaagatgaagatgtgctggctatgctgaagggttcacagttctgcaagatcagg
tcactcaagtggcaaaaggtccgcttctatcggctgcaggaggactgtatgaccgtgtgg
ttccagcggcgcttccgacatcctaaatctcatcacatcttctccttgcagaacattgag
gccgttcgccagggccatcagtccgaggggctgcgacgctatgggggctccttcccctcc
ggctgctgcctcactatcacgttcaagggccggcgcaagaatctggacctagcggcgctc
accgaggaggaggcccagcgctgggtgcgcggcctggccaagctccgggcacgtctggac
gccatgagccagagagaaaagcttgaccattggatccatggctacctacaccaggcagat
tcagaccatgacagcaagatgagttttaaagaaataaaaaacctgctccagatggtgaat
gtgaccatggatgacatgtatgcccaacaactattcaaggagtgtgacagctctcggaat
gcccggctcgagggcgccgaaatcgaggagttcctccgacggctattgaaacggcccgag
ctggagcaaatcttttaccgctattctggggaagaccgggtcctgagcgctgctgagctt
ctggagttcctccgcgaccagggagacgagggagccacgatggcccacgctcagcacctg
atccatacctatgagctgaatgagaaagctaaacagcatgaccttatgatgttggatggc
ttcatgatgtacctactgtcaccggagggtgccatcttggaccccacccaccaaggcgtg
taccaggacatgagccaacccctctctcattactttatctcctcctcgcacaacacctac
ctgacccagtcccagatcggcggtgccagcagcacggaggcctacatcagggcgtttgct
cagggctgcaggtgtgtggagctggactgttgggatgggcctgatggagaacccgtcatt
tatcacgggcacacactcacctccaaaatcctctttcgggatgtcatccacgtcgtgcgg
gaccacgccttctcgcaatctccctaccctgtcatcttgtccctggaaaatcactgcggg
atggagcagcagtccactatggcccactacctacggaccatcttggggaacatgctggtg
actgaaactctcgatgggaaaattcccaaggaactgccctctccagagcagctgaaaggc
aagattttagtgaaagccaagaaacaaaatgttcatcagaaaaaagaagttcagtctgat
ctgcctgatgaggacaaagaaaaagaggaatctgaggaagaagaggaagagacagaggct
ggaaatcaaaataaagagaccaagagaagcccccaaatttcctctgagctctcagatctg
gttatttactgctgtgccttaaaagttgagaaactgcctagaatcaaccctcaaccctgc
tgggtcccttctttcactgagctcaaagccaggaaattcatcaaagaagacggaaacagc
tttgttcgacataacacttaccacctatgcagagtctatccgtgggggttcaagatgacc
tctgccaattataacccccaggagatgtggaatgggggctgccagctggtggccttgaac
ttccagactcctggatatgagatggacctgaataacggtcgcttcctggtgaatggaaaa
tgtggttatgtcctgaaacctgactttctgcggcaaaaagacacaacctttgaccctgaa
caccctgggcccccccagaccaccctcattatcaaggtgctaacagctcagcaattgccc
aaattgaacagagagaagccaaattctatagtggacccgctggtttgggtggagatctat
ggggtacctagggactgtgcccggaaaaacactaattatgtactcaacaatggatttaac
ccttactggggggagacgctcaagttcactctccgggcccccgagctggccttggtccga
tttgtagtgaaagattatgatgccatttcctctgatgatttcgtgggccaattcaccctg
cccttgtgcagcctaaagcaagggtaccgacacatccacttgtactctgaggatggagct
tctctctctccagccacactctttgtccacattcagatcaaaagtggaagcactggcagc
ctgagcttggctgtcactctacagtcctacacatgggactcagtatgggccactggggat
tctcgcttccatgaaaatcagaccaacagcggcgggttccatgtcctgctctga

DBGET integrated database retrieval system