KEGG   Sarcophilus harrisii (Tasmanian devil): 100916816Help
Entry
100916816         CDS       T02286                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100916816 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100916816 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100916816 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100916816 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100916816 (PLCD3)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100916816 (PLCD3)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100916816 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100916816 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 738 aa AA seqDB search
MDLNEDEDVLAMLKGSQFCKIRSLKWQKVRFYRLQEDCMTVWFQRRFRHPKSHHIFSLQN
IEAVRQGHQSEGLRRYGGSFPSGCCLTITFKGRRKNLDLAALTEEEAQRWVRGLAKLRAR
LDAMSQREKLDHWIHGYLHQADSDHDSKMSFKEIKNLLQMVNVTMDDMYAQQLFKECDSS
RNARLEGAEIEEFLRRLLKRPELEQIFYRYSGEDRVLSAAELLEFLRDQGDEGATMAHAQ
HLIHTYELNEKAKQHDLMMLDGFMMYLLSPEGAILDPTHQGVYQDMSQPLSHYFISSSHN
TYLTQSQIGGASSTEAYIRAFAQGCRCVELDCWDGPDGEPVIYHGHTLTSKILFRDVIHV
VRDHAFSQSPYPVILSLENHCGMEQQSTMAHYLRTILGNMLVTETLDGKIPKELPSPEQL
KGKILVKAKKQNVHQKKEVQSDLPDEDKEKEESEEEEEETEAGNQNKETKRSPQISSELS
DLVIYCCALKVEKLPRINPQPCWVPSFTELKARKFIKEDGNSFVRHNTYHLCRVYPWGFK
MTSANYNPQEMWNGGCQLVALNFQTPGYEMDLNNGRFLVNGKCGYVLKPDFLRQKDTTFD
PEHPGPPQTTLIIKVLTAQQLPKLNREKPNSIVDPLVWVEIYGVPRDCARKNTNYVLNNG
FNPYWGETLKFTLRAPELALVRFVVKDYDAISSDDFVGQFTLPLCSLKQGYRHIHLYSED
GASLSPATLFVHIQIKSQ
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaatgaagatgaagatgtgctggctatgctgaagggttcacagttctgcaag
atcaggtcactcaagtggcaaaaggtccgcttctatcggctgcaggaggactgtatgacc
gtgtggttccagcggcgcttccgacatcctaaatctcatcacatcttctccttgcagaac
attgaggccgttcgccagggccatcagtccgaggggctgcgacgctatgggggctccttc
ccctccggctgctgcctcactatcacgttcaagggccggcgcaagaatctggacctagcg
gcgctcaccgaggaggaggcccagcgctgggtgcgcggcctggccaagctccgggcacgt
ctggacgccatgagccagagagaaaagcttgaccattggatccatggctacctacaccag
gcagattcagaccatgacagcaagatgagttttaaagaaataaaaaacctgctccagatg
gtgaatgtgaccatggatgacatgtatgcccaacaactattcaaggagtgtgacagctct
cggaatgcccggctcgagggcgccgaaatcgaggagttcctccgacggctattgaaacgg
cccgagctggagcaaatcttttaccgctattctggggaagaccgggtcctgagcgctgct
gagcttctggagttcctccgcgaccagggagacgagggagccacgatggcccacgctcag
cacctgatccatacctatgagctgaatgagaaagctaaacagcatgaccttatgatgttg
gatggcttcatgatgtacctactgtcaccggagggtgccatcttggaccccacccaccaa
ggcgtgtaccaggacatgagccaacccctctctcattactttatctcctcctcgcacaac
acctacctgacccagtcccagatcggcggtgccagcagcacggaggcctacatcagggcg
tttgctcagggctgcaggtgtgtggagctggactgttgggatgggcctgatggagaaccc
gtcatttatcacgggcacacactcacctccaaaatcctctttcgggatgtcatccacgtc
gtgcgggaccacgccttctcgcaatctccctaccctgtcatcttgtccctggaaaatcac
tgcgggatggagcagcagtccactatggcccactacctacggaccatcttggggaacatg
ctggtgactgaaactctcgatgggaaaattcccaaggaactgccctctccagagcagctg
aaaggcaagattttagtgaaagccaagaaacaaaatgttcatcagaaaaaagaagttcag
tctgatctgcctgatgaggacaaagaaaaagaggaatctgaggaagaagaggaagagaca
gaggctggaaatcaaaataaagagaccaagagaagcccccaaatttcctctgagctctca
gatctggttatttactgctgtgccttaaaagttgagaaactgcctagaatcaaccctcaa
ccctgctgggtcccttctttcactgagctcaaagccaggaaattcatcaaagaagacgga
aacagctttgttcgacataacacttaccacctatgcagagtctatccgtgggggttcaag
atgacctctgccaattataacccccaggagatgtggaatgggggctgccagctggtggcc
ttgaacttccagactcctggatatgagatggacctgaataacggtcgcttcctggtgaat
ggaaaatgtggttatgtcctgaaacctgactttctgcggcaaaaagacacaacctttgac
cctgaacaccctgggcccccccagaccaccctcattatcaaggtgctaacagctcagcaa
ttgcccaaattgaacagagagaagccaaattctatagtggacccgctggtttgggtggag
atctatggggtacctagggactgtgcccggaaaaacactaattatgtactcaacaatgga
tttaacccttactggggggagacgctcaagttcactctccgggcccccgagctggccttg
gtccgatttgtagtgaaagattatgatgccatttcctctgatgatttcgtgggccaattc
accctgcccttgtgcagcctaaagcaagggtaccgacacatccacttgtactctgaggat
ggagcttctctctctccagccacactctttgtccacattcagatcaaaagtcagtga

DBGET integrated database retrieval system