KEGG   Sarcophilus harrisii (Tasmanian devil): 100916818Help
Entry
100916818         CDS       T02286                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100916818 (USP36)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100916818 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1142 aa AA seqDB search
MPIVDKLKEALKPGRKDSTDDGDLGKLLASSAKKVLLQKIEFEPASKSFSYQLESLKSKY
VLLNPKTEGSSRHRNCEETQIRRQGSDHGFENCSDGIPAPQKVLFPMDRLSLKWERIYRV
GAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHTRNCHQGGFCMLCVMQNHMIQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYIIDAMQKACLNGYTKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSNG
DPIMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNIKVVLNQQAYVLFY
LRIPGSKKSPEGPIAKTASVLPSRANSVVPEHIKKNISNGVVSSPLIGKKLDLVSMKKQH
TAEENGVPVSRNSFMIGSKSQNGNVQLKLPLGSLSPKLSAKPIHGPVILDKLGKKVKKPL
SLQHLSPSLKVSHGLNGTSSLSSTKLESRRQGSWENKNAMLATSPKLLPEVTVNGHGPKG
NGECSDPKRKDSISSSPEYSASSETARGPETPKNGVGCFYTSQETDYSAGERTKEPPGGE
DSKMVKLKSPVLTNTATEPTSIMSPPPAKKLALSSKKASTLRRATGNDLHSPPHSSFADH
TYPTKITHPASASSWPVSKIRAVSPPKSSSPLKSSFNSYSIKASPLLSSFRPSGMTEPHS
CSFASNPLPQVNGDNMSSSHQQQGTSNIPQSFSKKRRKKHVSEDRSYRNPEEEISQGNGE
AAADLSHVKKKKKRKHTEENHRSWTEVATSLTQEEQIQRSIWNRGLGRKYGLDVTVDRVE
EEKNQEMNGSHIGVVTDAHFCKKKKEKKRKRMEECNEEHFHYQKSSLDRDEPESVIESPR
KKKKKKRKQNSEQEVEENEHQKHQRKDCQSDHKVILKENSVCKDMSNQSPVVNGQHPGNI
ASYLFLEKKQAPFQLWNKEKESNVVQELLKYSSDKAYGKKVLTWDGEVSAISQDAIQYSR
LAQNETVIDDWDKEFDSGKEKKIKKFKREKKRNFNAFQKLQSRRNFWSVTHPAKVTSLSY
RR
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atgccaattgttgataagttaaaggaagctttgaaacctggtcggaaggattcaacagat
gatggcgatctggggaagcttttggcttcttctgcaaaaaaagtccttctacagaagata
gagtttgagcctgcaagcaagagtttctcttaccagttggagtccctaaagagcaaatat
gtgctgttgaatcccaaaacagagggttctagtcgccacagaaattgtgaggagacacag
atcaggagacagggcagtgatcatgggtttgaaaactgtagcgatggcattcctgcccca
cagaaagttctcttccctatggataggttatctttgaaatgggagcgaatttaccgagtt
ggagcaggtctccataatctaggtaacacctgcttcttgaactccaccatacagtgtttg
acctacacaccccctctagccaactacttgctgtccaaggaacacactcggaactgtcac
caaggaggtttttgtatgctctgtgttatgcagaatcacatgattcaagcctttgcgaat
agtggtaatgctatcaagccagtctcctttatccgagacttgaaaaaaattgctcggcac
ttccgctttggaaaccaggaagatgcacatgaatttcttcggtacattattgatgctatg
caaaaggcctgcttgaatggctatacaaaattagatcgtcagacacaggcaactactttg
gtccatcagatttttggaggttatctcagatctcgtgttaaatgttcagtatgtaagagc
gtctctgatacctatgacccctatttggatgttgcactggagatcaggcaagctgcaaat
attgtacgcgccttggagctatttgtaaaaccagatgtcttgagtggagaaaatgcttac
atgtgtgcaaaatgcaagaaaaaagtgccagccagtaagcgcttcacaattcataggaca
tccaatgtcttaactctttccctaaagcgctttgcaaatttcagtgggggtaagatcacc
aaggatgtaggatatccagaatttctcaatatacgaccatacatgtcacaaagtaatggt
gaccctatcatgtatggattatatgctgtacttgtccattcaggttatagctgccatgct
ggacattattactgttatgtgaaggctagcaatgggcagtggtaccaaatgaatgattct
ttggtccattctagtaatatcaaagtagtcctcaaccagcaagcttatgttttgttctat
ctcagaattccaggttctaagaaaagtcctgagggtcccattgcaaaaactgcctctgtc
cttcctagccgagcaaacagtgtggttcctgaacacatcaagaaaaatattagtaatggt
gttgtctcctcaccactaattggaaagaaattggacttggtatcaatgaaaaaacaacat
acagcagaagaaaatggtgtcccagtttccagaaatagctttatgatagggtctaaatca
cagaatggaaatgttcaactaaagctgcccttggggtccctgtccccaaaactttcagca
aagcccattcatggacccgtcatactggataaactggggaaaaaagtcaagaagcctctc
tccctgcaacacctttctccatcactaaaagtatctcacgggttaaatggcaccagcagc
ttaagtagcactaaacttgagagccgtagacaaggctcatgggagaacaagaatgctatg
ctagctacctcacctaagctcctgcctgaagtgactgtcaatggccatgggccaaagggt
aatggtgagtgttcagatcccaagaggaaggattccatcagttccagccctgagtattct
gccagtagtgagacagccagggggcccgagaccccgaagaatggagttggctgtttctat
acttctcaggaaacagactattctgctggtgagcgtaccaaagagccacctggtggagag
gattctaagatggtgaagttaaagtcccctgttctgaccaatactgccactgagcctaca
agcatcatgtcccccccaccagccaaaaaactggccctttcttccaagaaggccagcacc
ctacggagggcgaccggcaatgacctccattcacctccccattcatcattcgctgaccac
acctaccccacgaaaatcacccaccctgcctccgcctcttcttggcctgtcagtaaaatc
agggctgtttcacctcccaaatcatcaagtcctttgaagtcttccttcaattcctattca
atcaaagcttcaccactcctgtccagctttaggccttcagggatgaccgaaccacatagc
tgctcctttgcctctaatcccctgcctcaggtaaatggggacaacatgtcctcttctcac
cagcagcaggggaccagtaatatccctcaaagcttctccaaaaagagaaggaaaaagcat
gtaagtgaagatagatcatacagaaatccagaagaagaaatctcacagggaaatggagag
gcagcagctgacctttctcatgtaaagaaaaagaagaagaggaagcatacagaagaaaat
catagatcttggacagaagttgctacatctcttacacaggaagaacaaatacagagatca
atttggaatagagggttaggaaggaaatatgggttagatgtgactgttgatagggtggag
gaagagaaaaatcaagagatgaatgggagtcacataggagttgtgactgatgcccatttt
tgcaaaaagaaaaaggagaaaaaaagaaagagaatggaagaatgtaatgaggaacatttt
cactatcagaaatcatctttggacagggatgagccagagtctgttatagagtctccaagg
aaaaagaaaaaaaagaaaagaaagcaaaattcagaacaggaagtagaagagaacgagcac
caaaaacaccagagaaaggactgccaaagtgatcacaaggtcatccttaaagaaaacagt
gtttgcaaggacatgagcaatcagtctccagttgtgaatggccagcatcctggaaatatt
gcttcatatttgtttttggagaagaaacaggctccttttcagctctggaataaagagaaa
gaatctaatgtagtccaggaattgctcaagtattcatctgataaagcttatgggaaaaaa
gttttgacttgggatggcgaggtgtcagccatcagccaggatgctattcagtatagtaga
ctggcccagaatgagacagtgattgatgattgggacaaagaatttgattctgggaaggaa
aagaaaataaagaagtttaaacgagagaagaaaagaaacttcaatgccttccagaaactt
cagagcaggcggaacttttggtctgtaacccatccagctaaagttacaagcctcagctac
cgccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system