KEGG   Sarcophilus harrisii (Tasmanian devil): 100917022Help
Entry
100917022         CDS       T02286                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C, epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100917022 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100917022 (PLCE1)
   04015 Rap1 signaling pathway
    100917022 (PLCE1)
   04020 Calcium signaling pathway
    100917022 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100917022 (PLCE1)
   04024 cAMP signaling pathway
    100917022 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100917022 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100917022 (PLCE1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917022 (PLCE1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100917022 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1912 aa AA seqDB search
MNDEMNIEKLMMTINNTVRKGEETERTFGSIFHFFGKTLALDIIHGHINIGPCLKQCVRD
TSCEYRATFQRTSISQYITGSLLEATASLGARSGLLNTFGGSVGRTMLKERQPCTSTASS
INLPSNVSGLSNELIELQHLIQFPEEVACILTEQEQNIYRQVLPVDYLCFLTRDLGNAEC
QSKLPCLRATVSASILTPQNNEHSALENLVTRFNEVSSWVTWLILTAGTMEEKREVFSYL
VHIAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEYK
KVVNRALNIPGCKVVPFCGVFLKELCEILDGTSGFMKLCPRYNSQDETLEFVADYNGQDN
FLQRVGQDGLNNPEKESTVNSIFQIIRSCNRSLEPEEEDSLSEGDDSRKNSLKDKTRLQF
VIGELSDSESDIFEQAKEWDFHGTEEEQKAFKHGTELIPWYVLSIRADVHQFILQGATVI
HYDQDAHLSARCFLRLQPDNSTLTWIKPTTASLANTKAKLGITGNLADPGKLQSLGNTGL
NGLMEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLSNMSLLENSVTLLYGLQTTENRLLHF
VAPKHTAKMLYNGLLELTKAVRKMKKFPDQRQQWLRKQYVSLYQEDGRFEGPTLAHAIEL
FGGRRWTTRNTSPATLSKSVEKPIVQRNNTLGISANKKKKKILMRGESGEGTDDEMATRK
AKMHKECRGRSGSDPQDLNEQEESDQNVIISPCNNLPSRRANSLTTAGSPNLAAGATSPV
RPLSSPVLSPSNKNQPNTWSSSSWHGRVKGGLKGFQNFMVSDSNMSFVEFVELFKSFSVR
SRKDLKDLFDIYAVPCSRSGSESVPLYTNLRIDENTSGLQPDLDLLTRNVSDLGLFIKNR
QQLSDNQRQISDAIAAASIVTNGSGIESTTLGVCGVGILQLNDFLVNCQGEHYTYDEILS
IIQKFEPSVSMYQQGLMSFEGFSRFLMDKDNFASQNDESQENVKELQLPLSYYYIESSHN
TYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEA
IDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKNVFGEKLVAKFLFESDFSDDPMLPSP
DQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQTQSNNGGNANPMSANNEEEEEEEDE
YDYDYESLSDDNILEDRPESKSASDKLQFEYNEEIPKRIKKADSSVCNKGKVYDMELGEE
FYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPSGSNRGKERKSRKSIFGNNPGRL
SPGETAAYTKTSGKSPLDGVRQTWEEVCSLSTAPSLSAIIRTPRCYHISSLNENAAKRLC
RRYSRKLIQHTACQLLRTYPAATRIDSSNPNPLLFWLHGIQLVALNYQTDDLPLHLNTAM
FEANGGCGYVLKPPVLWDKNCAMYQQFSPLERDMENMEPALYSLTIVSGQNVCPSNSTGS
PCIEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAVT
AQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEEHSSGSAVAASLMFSTEERK
GLMTYKVTVHGIPGPEPFAIFIINKEIKAKQLLHQILTASQNSIPVTPDCFLMEEKYFIS
KEKNDFRKQPFQRIIGPEEEIVQILNSWFPEEGYVGRIIFKIQEERPEEKNIFQEEKEVM
LSSEDESFFVQVHDVSPEQPRTVIKAPRVSTAQEVIQQTLCKAKYSYSILSNPNPSDYVL
LEEVLKEPASKKSSTPKSSQRVLGDQECVFQAQSRWKGAGKFILKLKEQVQAARDDKKKG
ISFANELKKFAKSSKQYRGFTSPSQLSIAESVQMKEEKSVGSFSSETTDHHP
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgaaatgaacattgagaagttaatgatgacaatcaacaacactgtgagaaaa
ggagaagaaacagaacgcacttttggatcaattttccatttctttgggaagactctagcc
ttagatataatccatggacatattaatattggcccatgcttgaagcaatgtgttcgagat
acttcatgtgaataccgagctacctttcaaaggacttcaatttctcagtatatcactggt
tctctattggaagcaactgcgtctctgggtgcaagaagtggccttttaaatacttttgga
ggatcagtaggaagaacaatgttgaaagaacgtcaaccatgtacctccacagccagttca
atcaacttaccttcaaatgtatctggtttaagtaacgagctcatagaacttcaacacctc
attcagttccctgaagaagtggcttgtattctgactgaacaggagcagaatatctaccga
caagtgctacctgtcgactacctttgcttcttaaccagggacttgggaaatgctgaatgc
cagagtaaacttccatgcctcagagctacagtatctgcatctattcttaccccccagaac
aatgagcacagtgctctggaaaaccttgtaacaagatttaatgaggtgagttcttgggtg
acgtggctgatactcacagcaggtaccatggaagaaaaacgggaagtcttctcatattta
gtacacattgcaaaatgctgctggaatatgggcaactacaatgctgttatggaattcttg
gctggcctcaggtcaaggaaagttttaaagatgtggcagtttatggaccagtctgatatt
gaaaccatgagaagcctgaaggatgcaatggcccaacatgaatcttcctctgaatacaag
aaagtggtaaaccgggctctgaatatccctggctgtaaagtggttcctttctgtggtgtc
tttttaaaggagctctgtgaaattctagatggaacatctggatttatgaaactttgccca
cgatataattcacaagatgaaactttagagtttgtagctgattacaatggacaagataat
tttttacaacgagtaggacaagatggcttaaacaacccagagaaagaatccactgtcaac
agtatttttcaaattatccgaagctgcaatcgtagtctggaacctgaagaagaagacagc
ttaagtgaaggcgatgattcaaggaaaaattccttgaaagataaaacccgactacagttt
gtaattggagaactgtctgattcagaaagtgatatttttgagcaggccaaagaatgggat
ttccatggaacggaagaagagcagaaagcattcaagcatggcacagaactcattccctgg
tatgtcttgtcaattagagctgatgtccatcagttcatactccaaggagccactgttatt
cactatgaccaggatgcacatctgtcagcacgatgctttcttcgacttcaacctgataat
agtactttgacctggatcaaacctacaactgcctcactcgccaatactaaagccaaatta
ggcatcacaggaaatttagctgaccctggcaaacttcaatcacttggcaatactggatta
aatggactgatggaaggttttctggatttgttttcagtcaaggctgtgtacatgggacat
cctggcattgatatgcacactgtgtgtgttcagaacaaactcagtaacatgtccctctta
gagaatagtgtgacactgctttatggccttcaaactactgagaatagattattacacttt
gtggcaccaaaacatactgctaaaatgttgtataatggattattagaattaacaaaagct
gtaagaaaaatgaagaaatttcctgaccagcgacagcagtggctaaggaagcaatatgtc
agcctctatcaggaggatggaagatttgaaggtccaactttggctcatgctatcgaactg
tttggtggcagacgttggactacacgaaatacaagtccagcaacactttctaaaagtgtg
gagaaacccattgtgcaaaggaacaacacccttgggataagtgcaaataagaaaaagaaa
aaaatccttatgaggggtgaaagtggagagggtactgatgatgagatggccacacgaaag
gcaaaaatgcataaggaatgccgtggccgcagtggctcagatcctcaagaccttaatgag
caagaagaatcagatcagaatgttattattagtccctgtaataatctgccatccaggaga
gccaattctttgactacagctggatctcctaacttggctgctggagcaacttcaccagtc
agaccactttcctctcctgtattgtcaccttcaaataagaatcagcctaatacatggagc
agcagtagttggcatggccgagttaaaggtggactgaagggatttcaaaatttcatggtt
tcagatagtaacatgagttttgttgaatttgtagagctgttcaagtcattcagtgtacga
agtcgaaaggacctcaaggatctttttgacatctatgctgtaccctgcagtcgatcagga
tctgagtctgtcccactctatacaaacctgagaattgatgaaaataccagtggccttcag
cctgatttagatttgttaaccaggaacgtgtctgacttgggcttgttcattaagaatagg
caacagttatcagacaaccagaggcagatatctgatgccatcgcagctgctagtattgtg
actaatggttctggaatagaaagcaccacgcttggtgtctgtggggttggcatattacag
ctgaatgactttttagtgaattgccaaggggaacactacacttatgatgagatcctcagc
attatccagaaattcgagcctagtgtgagtatgtatcagcaaggtctaatgtcatttgaa
ggattttccaggtttctgatggataaagataattttgcttcccaaaatgatgaatcacag
gagaatgttaaagaattgcagttaccactctcctattattacattgaatcttcacacaac
acatacctcacaggacatcagcttaaaggagagtcctcagtggagctatatagccaggtc
ctcttgcaaggctgtcggagtgtggaattagactgttgggatggtgatgatggaatgcca
attatctatcatggacatacacttactaccaagattcccttcaaggaagtagttgaagcc
attgatcgcagtgccttcatcaactctgacttgcctattataatatctatagaaaatcac
tgttcattgcctcagcaacgaaaaatggcagaaattttcaagaatgtatttggagaaaaa
ctagttgccaaatttttgtttgagagtgatttctctgatgatccaatgcttccttcacct
gaccaacttaggagaaaagtacttcttaaaaacaaaaaactgaaggcacatcagactcca
gtggacatattaaagcaaaaggctcatcaactggcatccatgcaaacacaaagcaataat
ggtggtaatgccaatcctatgtctgccaacaatgaagaagaagaggaggaggaggatgaa
tatgattatgactatgaatctctttctgatgacaacatcctggaagaccggcctgaaagt
aagtcagcaagtgacaaactacagtttgagtacaatgaagaaattcccaagagaatcaag
aaggctgacagctctgtttgcaacaagggaaaggtttatgacatggaactgggtgaagaa
ttttatcttccacagaataaaaaagagagtagacagatagctccagagctttctgacctt
gtcatctactgccaagctgtaaaatttccaggattgtcaactttaaacccatctggctct
aacagaggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggcagatta
agccctggggagacagcagcatataccaaaacatctggaaaaagtcccttggacggcgtg
cggcagacctgggaagaagtctgttctctcagcacagctccgtccctcagtgccatcatc
aggacccccaggtgctaccacatctcctccctgaacgagaatgcggccaagcggctgtgc
cgccggtactctcggaagctgattcagcacaccgcctgccagctgctgagaacctaccct
gccgccactcgcattgactcctccaaccccaatcccctcctgttctggctgcacgggata
cagctggtggcactcaactaccaaacagacgatctccccttacacctaaacacagcaatg
tttgaagctaatggtggctgtggctatgttttgaaaccccctgttttatgggacaagaat
tgtgctatgtaccagcagttttctccactggaaagagatatggaaaacatggaacctgct
ctctattctttaactattgtctctggtcagaatgtgtgtcctagtaacagtacaggaagt
ccatgtattgaaatcgatgtcctgggaatgcctctggatagctgccatttccgcactaaa
cccattcatcgaaatactcttaaccccatgtggaacgaacagtttctcttccgagttcat
tttgaagatcttgtatttcttcgttttgcggttgttgaaaacaacagttcagctgtaact
gcccaaagaatcattccactgaaggctttaaaaagaggatatcggcatcttcagctgaga
aacctccataatgaagtcttagaaatctctagcttgttcataaacagcaggaggatggaa
gagcattccagtggcagtgctgtggcagcatctttgatgttcagcacagaagaaagaaaa
ggtctgatgacatacaaggtcacagtacatgggattccaggtcctgagccttttgccatt
ttcattataaataaagaaattaaagcaaagcagcttcttcaccaaattttgactgcttca
caaaactccataccagtcactccggactgttttttaatggaagaaaaatattttatatct
aaagaaaaaaatgacttcaggaaacaaccattccagagaataatcggtccagaagaagag
attgtgcagattttgaacagctggttcccagaagaaggttatgttggaaggattattttt
aaaatccaggaggaacgcccagaagagaagaacatcttccaagaagagaaggaggtgatg
ctgagctcagaagatgaaagcttctttgtacaagtccatgatgtttctcccgagcagccc
cgaacagtcatcaaagctccccgagtcagcactgcccaggaggtcatccagcagactcta
tgcaaagcaaaatattcttacagcattttgagcaatcccaacccgagtgactacgtgctc
ctagaggaggtactaaaggaacctgctagcaagaagtcttcaacacccaagtcttctcag
agagttctcggggaccaggagtgtgtgttccaggctcaaagcaggtggaagggagccggg
aaatttatccttaagctaaaagagcaggttcaggcagctcgagatgataaaaagaaaggc
atttcctttgctaatgaacttaagaaatttgccaagtctagcaagcagtatcgaggattc
acctcaccttctcagctttcaatagcagaaagtgtccagatgaaggaagaaaaatctgtg
ggcagcttctcttctgagacgacagaccatcacccatga

DBGET integrated database retrieval system