KEGG   Sarcophilus harrisii (Tasmanian devil): 100917022Help
Entry
100917022         CDS       T02286                                 

Gene name
PLCE1
Definition
(RefSeq) LOW QUALITY PROTEIN: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04024  cAMP signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04919  Thyroid hormone signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05205  Proteoglycans in cancer
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100917022 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100917022 (PLCE1)
   04015 Rap1 signaling pathway
    100917022 (PLCE1)
   04020 Calcium signaling pathway
    100917022 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100917022 (PLCE1)
   04024 cAMP signaling pathway
    100917022 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100917022 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100917022 (PLCE1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917022 (PLCE1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100917022 (PLCE1)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100917022 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100917022 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100917022
NCBI-ProteinID: XP_023350833
Ensembl: ENSSHAG00000015174
Position
1
AA seq 1910 aa AA seqDB search
MNASCXLNYLQINNTVRKGEETERTFGSIFHFFGKTLALDIIHGHINIGPCLKQCVRDTS
CEYRATFQRTSISQYITGSLLEATASLGARSGLLNTFGGSVGRTMLKERQPCTSTASSIN
LPSNVSGLSNELIELQHLIQFPEEVACILTEQEQNIYRQVLPVDYLCFLTRDLGNAECQS
KLPCLRATVSASILTPQNNEHSALENLVTRFNEVSSWVTWLILTAGTMEEKREVFSYLVH
IAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEYKKV
VNRALNIPGCKVVPFCGVFLKELCEILDGTSGFMKLCPRYNSQDETLEFVADYNGQDNFL
QRVGQDGLNNPEKESTVNSIFQIIRSCNRSLEPEEEDSLSEGDDSRKNSLKDKTRLQFVI
GELSDSESDIFEQAKEWDFHGTEEEQKAFKHGTELIPWYVLSIRADVHQFILQGATVIHY
DQDAHLSARCFLRLQPDNSTLTWIKPTTASLANTKAKLGITGNLADPGKLQSLGNTGLNG
LMEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLSNMSLLENSVTLLYGLQTTENRLLHFVA
PKHTAKMLYNGLLELTKAVRKMKKFPDQRQQWLRKQYVSLYQEDGRFEGPTLAHAIELFG
GRRWTTRNTSPATLSKSVEKPIVQRNNTLGISANKKKKKILMRGESGEGTDDEMATRKAK
MHKECRGRSGSDPQDLNEQEESDQNVIISPCNNLPSRRANSLTTAGSPNLAAGATSPVRP
LSSPVLSPSNKNQPNTWSSSSWHGRVKGGLKGFQNFMVSDSNMSFVEFVELFKSFSVRSR
KDLKDLFDIYAVPCSRSGSESVPLYTNLRIDENTSGLQPDLDLLTRNVSDLGLFIKNRQQ
LSDNQRQISDAIAAASIVTNGSGIESTTLGVCGVGILQLNDFLVNCQGEHYTYDEILSII
QKFEPSVSMYQQGLMSFEGFSRFLMDKDNFASQNDESQENVKELQLPLSYYYIESSHNTY
LTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAID
RSAFINSDLPIIISIENHCSLPQQRKMAEIFKNVFGEKLVAKFLFESDFSDDPMLPSPDQ
LRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQTQSNNGGNANPMSANNEEEEEEEDEYD
YDYESLSDDNILEDRPESKSASDKLQFEYNEEIPKRIKKADSSVCNKGKVYDMELGEEFY
LPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPSGSNRGKERKSRKSIFGNNPGRLSP
GETAAYTKTSGKSPLDGVRQTWEEVCSLSTAPSLSAIIRTPRCYHISSLNENAAKRLCRR
YSRKLIQHTACQLLRTYPAATRIDSSNPNPLLFWLHGIQLVALNYQTDDLPLHLNTAMFE
ANGGCGYVLKPPVLWDKNCAMYQQFSPLERDMENMEPALYSLTIVSGQNVCPSNSTGSPC
IEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAVTAQ
RIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEEHSSGSAVAASLMFSTEERKGL
MTYKVTVHGIPGPEPFAIFIINKEIKAKQLLHQILTASQNSIPVTPDCFLMEEKYFISKE
KNDFRKQPFQRIIGPEEEIVQILNSWFPEEGYVGRIIFKIQEERPEEKNIFQEEKEVMLS
SEDESFFVQVHDVSPEQPRTVIKAPRVSTAQEVIQQTLCKAKYSYSILSNPNPSDYVLLE
EVLKEPASKKSSTPKSSQRVLGDQECVFQAQSRWKGAGKFILKLKEQVQAARDDKKKGIS
FANELKKFAKSSKQYRGFTSPSQLSIAESVQMKEEKSVGSFSSETTDHHP
NT seq 5733 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttcctgtnatttgaattatttacagatcaacaacactgtgagaaaaggagaa
gaaacagaacgcacttttggatcaattttccatttctttgggaagactctagccttagat
ataatccatggacatattaatattggcccatgcttgaagcaatgtgttcgagatacttca
tgtgaataccgagctacctttcaaaggacttcaatttctcagtatatcactggttctcta
ttggaagcaactgcgtctctgggtgcaagaagtggccttttaaatacttttggaggatca
gtaggaagaacaatgttgaaagaacgtcaaccatgtacctccacagccagttcaatcaac
ttaccttcaaatgtatctggtttaagtaacgagctcatagaacttcaacacctcattcag
ttccctgaagaagtggcttgtattctgactgaacaggagcagaatatctaccgacaagtg
ctacctgtcgactacctttgcttcttaaccagggacttgggaaatgctgaatgccagagt
aaacttccatgcctcagagctacagtatctgcatctattcttaccccccagaacaatgag
cacagtgctctggaaaaccttgtaacaagatttaatgaggtgagttcttgggtgacgtgg
ctgatactcacagcaggtaccatggaagaaaaacgggaagtcttctcatatttagtacac
attgcaaaatgctgctggaatatgggcaactacaatgctgttatggaattcttggctggc
ctcaggtcaaggaaagttttaaagatgtggcagtttatggaccagtctgatattgaaacc
atgagaagcctgaaggatgcaatggcccaacatgaatcttcctctgaatacaagaaagtg
gtaaaccgggctctgaatatccctggctgtaaagtggttcctttctgtggtgtcttttta
aaggagctctgtgaaattctagatggaacatctggatttatgaaactttgcccacgatat
aattcacaagatgaaactttagagtttgtagctgattacaatggacaagataatttttta
caacgagtaggacaagatggcttaaacaacccagagaaagaatccactgtcaacagtatt
tttcaaattatccgaagctgcaatcgtagtctggaacctgaagaagaagacagcttaagt
gaaggcgatgattcaaggaaaaattccttgaaagataaaacccgactacagtttgtaatt
ggagaactgtctgattcagaaagtgatatttttgagcaggccaaagaatgggatttccat
ggaacggaagaagagcagaaagcattcaagcatggcacagaactcattccctggtatgtc
ttgtcaattagagctgatgtccatcagttcatactccaaggagccactgttattcactat
gaccaggatgcacatctgtcagcacgatgctttcttcgacttcaacctgataatagtact
ttgacctggatcaaacctacaactgcctcactcgccaatactaaagccaaattaggcatc
acaggaaatttagctgaccctggcaaacttcaatcacttggcaatactggattaaatgga
ctgatggaaggttttctggatttgttttcagtcaaggctgtgtacatgggacatcctggc
attgatatgcacactgtgtgtgttcagaacaaactcagtaacatgtccctcttagagaat
agtgtgacactgctttatggccttcaaactactgagaatagattattacactttgtggca
ccaaaacatactgctaaaatgttgtataatggattattagaattaacaaaagctgtaaga
aaaatgaagaaatttcctgaccagcgacagcagtggctaaggaagcaatatgtcagcctc
tatcaggaggatggaagatttgaaggtccaactttggctcatgctatcgaactgtttggt
ggcagacgttggactacacgaaatacaagtccagcaacactttctaaaagtgtggagaaa
cccattgtgcaaaggaacaacacccttgggataagtgcaaataagaaaaagaaaaaaatc
cttatgaggggtgaaagtggagagggtactgatgatgagatggccacacgaaaggcaaaa
atgcataaggaatgccgtggccgcagtggctcagatcctcaagaccttaatgagcaagaa
gaatcagatcagaatgttattattagtccctgtaataatctgccatccaggagagccaat
tctttgactacagctggatctcctaacttggctgctggagcaacttcaccagtcagacca
ctttcctctcctgtattgtcaccttcaaataagaatcagcctaatacatggagcagcagt
agttggcatggccgagttaaaggtggactgaagggatttcaaaatttcatggtttcagat
agtaacatgagttttgttgaatttgtagagctgttcaagtcattcagtgtacgaagtcga
aaggacctcaaggatctttttgacatctatgctgtaccctgcagtcgatcaggatctgag
tctgtcccactctatacaaacctgagaattgatgaaaataccagtggccttcagcctgat
ttagatttgttaaccaggaacgtgtctgacttgggcttgttcattaagaataggcaacag
ttatcagacaaccagaggcagatatctgatgccatcgcagctgctagtattgtgactaat
ggttctggaatagaaagcaccacgcttggtgtctgtggggttggcatattacagctgaat
gactttttagtgaattgccaaggggaacactacacttatgatgagatcctcagcattatc
cagaaattcgagcctagtgtgagtatgtatcagcaaggtctaatgtcatttgaaggattt
tccaggtttctgatggataaagataattttgcttcccaaaatgatgaatcacaggagaat
gttaaagaattgcagttaccactctcctattattacattgaatcttcacacaacacatac
ctcacaggacatcagcttaaaggagagtcctcagtggagctatatagccaggtcctcttg
caaggctgtcggagtgtggaattagactgttgggatggtgatgatggaatgccaattatc
tatcatggacatacacttactaccaagattcccttcaaggaagtagttgaagccattgat
cgcagtgccttcatcaactctgacttgcctattataatatctatagaaaatcactgttca
ttgcctcagcaacgaaaaatggcagaaattttcaagaatgtatttggagaaaaactagtt
gccaaatttttgtttgagagtgatttctctgatgatccaatgcttccttcacctgaccaa
cttaggagaaaagtacttcttaaaaacaaaaaactgaaggcacatcagactccagtggac
atattaaagcaaaaggctcatcaactggcatccatgcaaacacaaagcaataatggtggt
aatgccaatcctatgtctgccaacaatgaagaagaagaggaggaggaggatgaatatgat
tatgactatgaatctctttctgatgacaacatcctggaagaccggcctgaaagtaagtca
gcaagtgacaaactacagtttgagtacaatgaagaaattcccaagagaatcaagaaggct
gacagctctgtttgcaacaagggaaaggtttatgacatggaactgggtgaagaattttat
cttccacagaataaaaaagagagtagacagatagctccagagctttctgaccttgtcatc
tactgccaagctgtaaaatttccaggattgtcaactttaaacccatctggctctaacaga
ggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggcagattaagccct
ggggagacagcagcatataccaaaacatctggaaaaagtcccttggacggcgtgcggcag
acctgggaagaagtctgttctctcagcacagctccgtccctcagtgccatcatcaggacc
cccaggtgctaccacatctcctccctgaacgagaatgcggccaagcggctgtgccgccgg
tactctcggaagctgattcagcacaccgcctgccagctgctgagaacctaccctgccgcc
actcgcattgactcctccaaccccaatcccctcctgttctggctgcacgggatacagctg
gtggcactcaactaccaaacagacgatctccccttacacctaaacacagcaatgtttgaa
gctaatggtggctgtggctatgttttgaaaccccctgttttatgggacaagaattgtgct
atgtaccagcagttttctccactggaaagagatatggaaaacatggaacctgctctctat
tctttaactattgtctctggtcagaatgtgtgtcctagtaacagtacaggaagtccatgt
attgaaatcgatgtcctgggaatgcctctggatagctgccatttccgcactaaacccatt
catcgaaatactcttaaccccatgtggaacgaacagtttctcttccgagttcattttgaa
gatcttgtatttcttcgttttgcggttgttgaaaacaacagttcagctgtaactgcccaa
agaatcattccactgaaggctttaaaaagaggatatcggcatcttcagctgagaaacctc
cataatgaagtcttagaaatctctagcttgttcataaacagcaggaggatggaagagcat
tccagtggcagtgctgtggcagcatctttgatgttcagcacagaagaaagaaaaggtctg
atgacatacaaggtcacagtacatgggattccaggtcctgagccttttgccattttcatt
ataaataaagaaattaaagcaaagcagcttcttcaccaaattttgactgcttcacaaaac
tccataccagtcactccggactgttttttaatggaagaaaaatattttatatctaaagaa
aaaaatgacttcaggaaacaaccattccagagaataatcggtccagaagaagagattgtg
cagattttgaacagctggttcccagaagaaggttatgttggaaggattatttttaaaatc
caggaggaacgcccagaagagaagaacatcttccaagaagagaaggaggtgatgctgagc
tcagaagatgaaagcttctttgtacaagtccatgatgtttctcccgagcagccccgaaca
gtcatcaaagctccccgagtcagcactgcccaggaggtcatccagcagactctatgcaaa
gcaaaatattcttacagcattttgagcaatcccaacccgagtgactacgtgctcctagag
gaggtactaaaggaacctgctagcaagaagtcttcaacacccaagtcttctcagagagtt
ctcggggaccaggagtgtgtgttccaggctcaaagcaggtggaagggagccgggaaattt
atccttaagctaaaagagcaggttcaggcagctcgagatgataaaaagaaaggcatttcc
tttgctaatgaacttaagaaatttgccaagtctagcaagcagtatcgaggattcacctca
ccttctcagctttcaatagcagaaagtgtccagatgaaggaagaaaaatctgtgggcagc
ttctcttctgagacgacagaccatcacccatga

DBGET integrated database retrieval system