KEGG   Sarcophilus harrisii (Tasmanian devil): 100917051Help
Entry
100917051         CDS       T02286                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100917051 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100917051 (EEF2K)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100917051 (EEF2K)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [Table]
   100917051 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 642 aa AA seqDB search
MTVINESVLGPLSRIRCLEKEEFQETWKHAIEKAKHMPDPWAEFHLEDIETECANRHRYN
AVTGEWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQHWKGASNYVAKRYIEPVNR
DVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRADKPLFHLEHYIEGKYIK
YNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGSDFGDG
NLGVRGMALFFHSHACNRICKSMGLTPFDLSPKEKDAVNQNTKLLQSAQTLVRGTEEKCG
SPRVRTFSGSRPPLLSRLSENSGDENMSDMTFDSLPSSPSFTPHSQRIDHLHWPQFSEVD
NLGHKDHEHLDNRRDSENGGDSGYPSEKRNELEDIDARDRAHSNGNRKQYESDEDSLGSY
GRVSVEKWNLYNSARLHLQRPSCVAVEMQRLNDLDLERKIGKSILGKVHLAMVRYHEGGR
FCEKDQPWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLQESEENRTKGF
DYLLKAAEAGDRHSMILVARAYDTGLNLSSDRARDWQEALHWYDTALNTTDYDEGGEYDG
IQDDPRHTLLAREAEMLFTGGFQLEKDPKRSGPRLTEATPSQ
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgataaatgaaagtgtgcttggtccgcttagcagaatccggtgtctggaaaaa
gaggaattccaggaaacttggaaacatgccattgagaaagccaaacatatgcctgatccc
tgggccgaatttcatctcgaagatatcgaaactgagtgtgctaaccgtcacaggtataat
gcagtcactggggaatgggttgaagatgaagttttaatcaaaatggcatcacagcccttt
ggacgcggagcaatgcgggagtgtttcagaacgaaaaagctgtctaatttcctgcacact
caacactggaaaggtgcttctaactacgtggcaaagaggtacattgagcccgtgaacaga
gacgtatactttgaggatgttcgcctgcaaatggaggccaaactctggggcgaggaatat
aaccggcacaaaccccccaagcaggtggatattatgcagatgtgcatcattgagttgaag
gatcgagcagacaagcccctttttcacctggaacactatattgagggcaaatatatcaaa
tataattccaattcgggatttgtccgagatgacaacattcgcctaaccccacaggctttc
agccacttcacctttgaacgttctggccatcagctgattgtggtggacattcagggagtg
ggggatctctacactgacccacagattcatacagagacgggctcagactttggagatggc
aatctaggtgtacggggtatggccttgttcttccactctcacgcctgcaatcggatttgc
aagagcatgggtcttactccctttgacctctcaccaaaggaaaaggatgctgttaatcag
aataccaagttgttgcaatcagcccagacccttgtgcggggcacagaggaaaagtgtggc
agtccaagggtgaggaccttctcagggagccgtccaccattgctttcccgcctttcagag
aactctggagatgaaaatatgagtgacatgacatttgattccctcccttcctctccttca
tttacaccacacagccagagaatagaccatctccactggccacaattcagtgaggttgat
aacctgggacacaaagatcatgaacatctggataaccgtcgagattctgagaatggtggg
gacagtggatatccaagtgaaaagaggaatgaactggaagacatagatgctcgagacagg
gcccattcaaatggcaaccggaaacagtatgaatctgatgaagatagtctgggcagttat
ggaagggtcagtgtggagaaatggaatctctataactctgccaggcttcacctccagcgg
ccatcctgtgttgctgtggaaatgcagagacttaatgatctggaccttgaaaggaaaatc
gggaagtccattttggggaaggttcacctggccatggtgcgttaccatgaagggggacgc
ttttgtgagaaggatcagccctgggatcaagagtcggctgtcttccatctggagcatgca
gcagatctgggggagctggaggccattgtggggctcgggctcatgtactcccaactcccc
caccacatcctggctgatgtctccttacaggagtcggaggaaaatagaacaaaaggattt
gattacttactgaaggctgcagaagcaggtgaccgtcattctatgattcttgtggcaaga
gcctatgacacaggtctgaacctcagctctgacagagcacgagactggcaggaggcccta
cactggtatgacactgcattaaacacgacagattatgatgaaggaggtgaatatgatgga
atacaagatgatccgaggcacacactcctggcaagagaggctgaaatgctatttacaggt
ggcttccagctagagaaagatccaaaaagatcaggtccccgtctgactgaggcaacaccc
agtcagtga

DBGET integrated database retrieval system