KEGG   Sarcophilus harrisii (Tasmanian devil): 100917477Help
Entry
100917477         CDS       T02286                                 

Definition
ribonuclease pancreatic gamma-type-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100917477
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     100917477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 180 aa AA seqDB search
MILILLGIHSLLLLLFHQGLAGDPPFVAKRQLAEQPGQPVNNRMSMSDNWSYKKRRFLEK
YVDEVEIPLPPDVYCNILVRNRNIMVSSSPCKKEHYFIHDSWNNILKLCENNNIPCKNST
NSCHQSTKTMAMTTCRLLNGDQFPYCEYISIKKKKKVVLSCKQLKGYPSLFPDSVEKIVE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgattcttctgggaatccactccctgttgctgctattgttccaccagggacta
gcaggagatcccccctttgtggctaagcggcaactagctgagcagcctggacagcctgtc
aacaatagaatgtcaatgtctgacaattggtcctacaaaaaaaggagattcttagaaaag
tatgttgatgaagtagagatccctctgcctccagatgtgtactgtaatatcttggttagg
aacagaaacatcatggtttcttcgagcccatgcaagaaagaacactatttcattcatgac
tcctggaataatatactaaagttgtgtgaaaataacaacatcccatgcaagaattccaca
aatagttgtcatcagagcacaaaaactatggctatgacaacttgtcggctactcaatggt
gatcagttcccttattgtgaatacatatccattaaaaaaaagaaaaaggtagtcctttcc
tgcaaacagctgaaaggttatccttctcttttccctgattctgtggaaaaaattgttgag
taa

DBGET integrated database retrieval system